Align 2-oxoacid oxidoreductase (ferredoxin) (subunit 1/2) (EC 1.2.7.11) (characterized)
to candidate 352364 BT2837 2-oxoglutarate synthase subunit korB (NCBI ptt file)
Query= BRENDA::Q4J6I8 (303 letters) >FitnessBrowser__Btheta:352364 Length = 336 Score = 186 bits (473), Expect = 5e-52 Identities = 96/212 (45%), Positives = 129/212 (60%), Gaps = 7/212 (3%) Query: 10 WCPGCGNFGILRAEEMAIQELGVDFKKVVLVSGIGCSGKMPHFVNLPVGGVHTLHGRALA 69 WCPGCG+ L + A+ ELGV + ++SGIGCS ++P++VN G HT+HGRA A Sbjct: 18 WCPGCGDHAFLNSLHKAMAELGVAPHNIAVISGIGCSSRLPYYVN--TYGFHTIHGRAAA 75 Query: 70 FATGIKLANPSLEVIVNVGDGDGLGIGMGHFVHLGRRNIDITLIVHDNGVYGLTKGQAAP 129 ATG K+ANP L + GDGDGL IG HF+H RRNID+ +I+ +N +YGLTKGQ +P Sbjct: 76 VATGAKVANPDLTIWQISGDGDGLAIGGNHFIHAVRRNIDLNMILLNNRIYGLTKGQYSP 135 Query: 130 TLERGIKTKSLPKPNINDAVNPLAVALSAGYTFIARAYAYDVIHLKEVIKRAIKHKGSAI 189 T ERG +KS P + D +P +A A F AR A D EV+K A HKG+++ Sbjct: 136 TSERGFVSKSSPYGTVEDPFHPAELAFGARGRFFARCIAVDGAASVEVLKAAANHKGASV 195 Query: 190 IDVFQPCPTYND-----INTKEWYDKRVYKLD 216 ++V Q C +ND + TKE K L+ Sbjct: 196 VEVLQNCVIFNDGTHASVATKEGRAKNAIYLE 227 Lambda K H 0.320 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 336 Length adjustment: 28 Effective length of query: 275 Effective length of database: 308 Effective search space: 84700 Effective search space used: 84700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory