Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate 353246 BT3720 putative aspartate aminotransferase (NCBI ptt file)
Query= SwissProt::P16524 (393 letters) >FitnessBrowser__Btheta:353246 Length = 383 Score = 234 bits (598), Expect = 2e-66 Identities = 141/385 (36%), Positives = 218/385 (56%), Gaps = 13/385 (3%) Query: 1 MEHLLNPKARE----IEISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDE 56 M+H NP+ + I + + + + L Q DVI L +G+PDF P V AAK A D Sbjct: 1 MKHT-NPQVEQMTSFIVMDVLERANELQKQGVDVIHLEVGEPDFDVPACVAEAAKAAYDR 59 Query: 57 NVTSYTPNAGYLELRQAVQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEV 116 ++T YT + G ELR+ + + +++ D + I++T+G+S +I + + EV Sbjct: 60 HLTHYTHSLGDPELRREIAAFYQREYGVTVDPDC-IVVTSGSSPSILLVLMLLCNSDSEV 118 Query: 117 IMPGPIYPGYEPIINLCGAKPVIVDTTS-HGFKLTARLIEDALTPNTKCVVLPYPSNPTG 175 I+ P Y Y + AKPV+V + +G + I +TP+T + + P NPTG Sbjct: 119 ILSNPGYACYRNFVLAAQAKPVLVPLSEENGLQYDIEAIRKCVTPHTAGIFINSPMNPTG 178 Query: 176 VTLSEEELKSIAALLKGRNVFVLSDEIYSELTYDRPHYSIATYLRDQTIVINGLSKSHSM 235 + L E L+S+A+L V ++SDEIY L Y+ +SI Y D+ V+NG SK +M Sbjct: 179 MLLDESFLRSVASL----GVPIISDEIYHGLVYEGRAHSILEYT-DKAFVLNGFSKRFAM 233 Query: 236 TGWRIGFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLD 295 TG R+G+L APK + + K+ Q CASSI+Q+A + A+ D M++ Y +R Sbjct: 234 TGLRLGYLIAPKSCMRSLQKLQQNLFICASSIAQQAGIAALRQADSDVERMKQIYDERRR 293 Query: 296 YVYDRLVSMGLDV-VKPSGAFYIFPSIKSFGMTSFDFSMALLEDAGVALVPGSSFSTYGE 354 Y+ RL MG ++ V+P GAFYIF + F S+ F+ +LE+A V + PG F T GE Sbjct: 294 YMISRLREMGFEIKVEPQGAFYIFADARKFTTDSYRFAFDVLENAHVGITPGIDFGTGGE 353 Query: 355 GYVRLSFACSMDTLREGLDRLELFV 379 GYVR S+A S++++REGLDR+ ++ Sbjct: 354 GYVRFSYANSLESIREGLDRISQYL 378 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 383 Length adjustment: 30 Effective length of query: 363 Effective length of database: 353 Effective search space: 128139 Effective search space used: 128139 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory