Align Meso-diaminopimelate D-dehydrogenase; DAPDH; Meso-DAP dehydrogenase; EC 1.4.1.16 (characterized)
to candidate 351507 BT1979 Meso-diaminopimelate D-dehydrogenase (NCBI ptt file)
Query= SwissProt::Q5L9Q6 (299 letters) >FitnessBrowser__Btheta:351507 Length = 299 Score = 562 bits (1449), Expect = e-165 Identities = 285/299 (95%), Positives = 289/299 (96%) Query: 1 MKKVRAAIVGYGNIGRYVLEALQAAPDFEIAGVVRRAGAENKPAELNDYAVVKDIKELQG 60 MKKVRAAIVGYGNIG YVLEALQAAPDFEIAGVVRRAGAENKP EL +YAVVKDIKEL+G Sbjct: 1 MKKVRAAIVGYGNIGHYVLEALQAAPDFEIAGVVRRAGAENKPEELANYAVVKDIKELEG 60 Query: 61 VDVAILCTPTRSVEKYAKEILAMGINTVDSFDIHTGIVDLRRELGACAKEHGAVSIISAG 120 V+VAILCTPTRSVEKYAKE LAMGINTVDSFDIHTGIVDLRR L A AKEH AVSIISAG Sbjct: 61 VEVAILCTPTRSVEKYAKEYLAMGINTVDSFDIHTGIVDLRRTLDATAKEHKAVSIISAG 120 Query: 121 WDPGSDSIVRTMLEAIAPKGITYTNFGPGMSMGHTVAVKAIDGVKAALSMTIPTGTGIHR 180 WDPGSDSIVRTMLEAIAPKGITYTNFGPGMSMGHTVAVKAIDGVKAALSMTIPTGTGIHR Sbjct: 121 WDPGSDSIVRTMLEAIAPKGITYTNFGPGMSMGHTVAVKAIDGVKAALSMTIPTGTGIHR 180 Query: 181 RMVYIELKDGYKFEEVAAAIKSDAYFVNDETHVKQVPSVDALLDMGHGVNLTRKGVSGKT 240 RMVYIELKDGYKFEEVAAAIK+D YFVNDETHVK VPSVDALLDMGHGVNLTRKGVSGKT Sbjct: 181 RMVYIELKDGYKFEEVAAAIKADPYFVNDETHVKLVPSVDALLDMGHGVNLTRKGVSGKT 240 Query: 241 QNQLFEFNMRINNPALTAQVLVCVARASMKQQPGCYTMVEVPVIDLLPGDREEWIGHLV 299 QNQLFEFNMRINNPALTAQVLVCVARASMKQQPGCYTMVEVPVIDLLPGDREEWIGHLV Sbjct: 241 QNQLFEFNMRINNPALTAQVLVCVARASMKQQPGCYTMVEVPVIDLLPGDREEWIGHLV 299 Lambda K H 0.319 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 299 Length adjustment: 27 Effective length of query: 272 Effective length of database: 272 Effective search space: 73984 Effective search space used: 73984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 351507 BT1979 (Meso-diaminopimelate D-dehydrogenase (NCBI ptt file))
to HMM TIGR01921 (diaminopimelate dehydrogenase (EC 1.4.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01921.hmm # target sequence database: /tmp/gapView.759.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01921 [M=324] Accession: TIGR01921 Description: DAP-DH: diaminopimelate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-150 486.6 0.5 2.3e-150 486.2 0.5 1.1 1 lcl|FitnessBrowser__Btheta:351507 BT1979 Meso-diaminopimelate D-de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351507 BT1979 Meso-diaminopimelate D-dehydrogenase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 486.2 0.5 2.3e-150 2.3e-150 1 324 [] 1 299 [] 1 299 [] 1.00 Alignments for each domain: == domain 1 score: 486.2 bits; conditional E-value: 2.3e-150 TIGR01921 1 mskiraaivGyGnlGksvekaisqaPdlelvgvfsrrdaetldeelavyavaeaekeledvdvlilctgsatdlke 76 m+k+raaivGyGn+G++v++a+++aPd+e++gv++r++ae+++eela+yav++++kele+v+v+ilct++++++k+ lcl|FitnessBrowser__Btheta:351507 1 MKKVRAAIVGYGNIGHYVLEALQAAPDFEIAGVVRRAGAENKPEELANYAVVKDIKELEGVEVAILCTPTRSVEKY 76 9*************************************************************************** PP TIGR01921 77 qkeylaafintvdsfdihadipelrrvldaaakeagkvsvisaGWdPGlfsinrvlgeavlpkgitytffGpGlsq 152 +keyla++intvdsfdih++i++lrr+lda+ake+++vs+isaGWdPG++si+r+++ea++pkgityt+fGpG+s+ lcl|FitnessBrowser__Btheta:351507 77 AKEYLAMGINTVDSFDIHTGIVDLRRTLDATAKEHKAVSIISAGWDPGSDSIVRTMLEAIAPKGITYTNFGPGMSM 152 **************************************************************************** PP TIGR01921 153 GhsdavrridGvkkavqytlPikdalekvrrgeaeeltgkekhkrevyvvlkegaeaekveaeiktmadyfveyet 228 Gh++av++idGvk+a+++t+P tg+++h+r+vy++lk+g+++e+v+a+ik++ +yfv++et lcl|FitnessBrowser__Btheta:351507 153 GHTVAVKAIDGVKAALSMTIP----------------TGTGIHRRMVYIELKDGYKFEEVAAAIKAD-PYFVNDET 211 *********************................******************************.9******* PP TIGR01921 229 evnlideaefdaehtgmphGgfvirkGesGktqkqllefslklernPdltasvlvavaraayrlkeagqkGaytvl 304 +v+l++++++ ++++ hG++++rkG+sGktq+ql+ef+++++ nP+lta+vlv+vara++++ q+G+yt++ lcl|FitnessBrowser__Btheta:351507 212 HVKLVPSVDALLDMG---HGVNLTRKGVSGKTQNQLFEFNMRIN-NPALTAQVLVCVARASMKQ----QPGCYTMV 279 ***************...**************************.*******************....******** PP TIGR01921 305 evpvillsPkdaeelikelv 324 evpvi+l+P+d+ee+i++lv lcl|FitnessBrowser__Btheta:351507 280 EVPVIDLLPGDREEWIGHLV 299 ******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (324 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.07 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory