Align isocitrate-homoisocitrate dehydrogenase (EC 1.1.1.286) (characterized)
to candidate 351599 BT2071 isocitrate dehydrogenase [NADP] (NCBI ptt file)
Query= BRENDA::Q4J6C9 (411 letters) >FitnessBrowser__Btheta:351599 Length = 396 Score = 347 bits (891), Expect = e-100 Identities = 178/394 (45%), Positives = 255/394 (64%), Gaps = 17/394 (4%) Query: 19 GKWVVPNKPIILYIEGDGIGPEITNSAIRVVNKAVEKAYKSSREIKWLEVYAGEKANKIT 78 G VP+ P++ YI GDG+G E+T S VVN AV+KAY R I+W EV AGE+A T Sbjct: 10 GTLSVPDVPVVPYITGDGVGAEVTPSMQSVVNAAVQKAYGGKRRIEWKEVLAGERAFNET 69 Query: 79 GDRFPKETQDMLLKYRVVLKGPLETPIGKGWKSINVAIRLMLDLYANIRPVKYIEGLESP 138 G P ET +Y + +KGPL TP+G G +S+NVA+R LDLY +RPV++ +G+ SP Sbjct: 70 GSWLPDETMKAFQEYLIGIKGPLTTPVGGGIRSLNVALRQTLDLYVCLRPVRWYQGVHSP 129 Query: 139 LKHPEKVDMIIFRENTDDLYRGIEFPYDSEEAKKIRKFLREEL---KVDIEDDTGIGLKV 195 +K PEKV+M +FRENT+D+Y GIE+ + EA+K +FL+ E+ KV + + G+K Sbjct: 130 VKAPEKVNMCVFRENTEDIYAGIEWEAGTPEAEKFYQFLKNEMGVTKVRFPETSSFGVKP 189 Query: 196 MSKFKTQRITRLALNYALQNSRKKVTVMHKGNVMKYTEGSFREWAYEVALNEYRDKIVTE 255 +S+ T+R+ R A YAL + VT++HKGN+MK+TEG F++W YE+A E+ D + Sbjct: 190 VSREGTERLVRAACQYALDHHLPSVTLVHKGNIMKFTEGGFKKWGYELAQREFGDAL--- 246 Query: 256 EEINRGVNSEGKVILNDRIADNMLQQIIIRPDEYDIILAPNVNGDYISDAAGALIGNIGM 315 ++G++++ D IAD LQ ++ P+EY +I N+NGDY+SD A++G IG+ Sbjct: 247 --------ADGRLVIKDCIADAFLQNTLLIPEEYSVIATLNLNGDYVSDQLAAMVGGIGI 298 Query: 316 LGGANIGDTGG--MFEAIHGTAPKYAGKNVANPTGIIKSCELMLYFMGWSEAARLIEKAI 373 GANI G +FEA HGTAP AGK+V NP II S +ML ++GW EAA LIEKA+ Sbjct: 299 APGANINYKTGHAIFEATHGTAPNIAGKDVVNPCSIILSAVMMLEYLGWKEAAALIEKAL 358 Query: 374 NESIKQKKVTQDIARYL-GITPLGTKEYTDTLVQ 406 +S + T D+AR++ G T L T +T +V+ Sbjct: 359 EQSFLDARATHDLARFMPGGTSLSTTAFTREIVE 392 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 396 Length adjustment: 31 Effective length of query: 380 Effective length of database: 365 Effective search space: 138700 Effective search space used: 138700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory