Align [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 (uncharacterized)
to candidate 350970 BT1442 adenosylmethionine-8-amino-7-oxononanoate aminotransferase (NCBI ptt file)
Query= curated2:Q9RW75 (429 letters) >FitnessBrowser__Btheta:350970 Length = 804 Score = 160 bits (405), Expect = 1e-43 Identities = 131/398 (32%), Positives = 214/398 (53%), Gaps = 34/398 (8%) Query: 32 RGQGATVWDENGRSYIDCVVGYGVATLGHSHPDVVKAVQEQAGKLM-VMPQTVPNDKRAE 90 R GAT+ E+GR+ I+ + + A G++HP + +A ++Q K+ VM + +D E Sbjct: 410 RADGATITLEDGRTLIEGMSSWWCAVHGYNHPVLNQAAKDQLDKMSHVMFGGLTHDPAIE 469 Query: 91 FLQELVGVLPQGLDRVFLCNSGTEAMEAAKKFAIT---ATGR---SRFVSMKRGFSGRSL 144 + L+ ++P + ++F +SG+ A+E A K A+ A G+ + FV+++ G+ G + Sbjct: 470 LGKLLLPLVPPSMQKIFYADSGSVAVEVALKMAVQYWYAAGKPDKNNFVTIRSGYHGDTW 529 Query: 145 GALSFTWEPK--YREPFGDA------VDNKSVDFVTYGNLDE---LRAAV---TEQTAAV 190 A+S +P FG + V S F N DE LR + +++ AA+ Sbjct: 530 NAMSVC-DPVTGMHSLFGSSLPVRYFVPAPSSRFDGEWNPDEIIPLRETIEKHSKELAAL 588 Query: 191 IMEP-VQGEGGVRPASAEFIQEARRITREKGALLILDEIQTGFCRTGKMFACEHFGVIPD 249 I+EP VQG GG+ ++++EA ++ +E LLI DEI TGF RTGK+FA EH GV PD Sbjct: 589 ILEPIVQGAGGMWFYHPQYLREAEKLCKEHDILLIFDEIATGFGRTGKLFAWEHAGVEPD 648 Query: 250 GMTLAKAIAGGTPTAAFAMMS-EVADRM-----PAGGHGTTFGGNPLSMAAGVASLRAMK 303 M + KA+ GG T + + S ++AD + A HG TF GNPL+ A AS+R + Sbjct: 649 IMCIGKALTGGYMTLSAVLASNQIADTISNHAPKAFMHGPTFMGNPLACAVACASVRLLL 708 Query: 304 REGLAEQAREKGAYMMDKLR-AIQSPKIREVRGLGLMIGVELKEKSA--PYIHAMEHDEG 360 G AE + A + ++L A + P++ +VR LG IGV E+S Y+ +EG Sbjct: 709 DSGWAENVKRIEAQLKEELAPARKFPQVADVRILG-AIGVIQTERSVSMAYMQRRFVEEG 767 Query: 361 VLCLAATPLVVRFLPPAVISKEQIDQVVAAFERVLNNV 398 + LV +PP +IS EQ+ ++ + +++ + Sbjct: 768 IWVRPFGKLVY-LMPPFIISPEQLSKLTSGVLKIVREM 804 Lambda K H 0.317 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 682 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 804 Length adjustment: 37 Effective length of query: 392 Effective length of database: 767 Effective search space: 300664 Effective search space used: 300664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory