Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate 353847 BT4321 2-dehydro-3-deoxyphosphooctonate aldolase (NCBI ptt file)
Query= BRENDA::P39912 (358 letters) >FitnessBrowser__Btheta:353847 Length = 266 Score = 104 bits (259), Expect = 3e-27 Identities = 77/248 (31%), Positives = 120/248 (48%), Gaps = 23/248 (9%) Query: 122 IVGPCAVESYEQVAEVA-----AAAKKQGIKILRGGAFKPRTSPYD-FQGLGVE-GLQIL 174 + GPC +E E +A K Q + +G K S D F G+G E L++L Sbjct: 15 LAGPCVIEGEEMAMRIAERVVGVTEKLQIPYVFKGSYRKANRSRLDSFTGIGDEKALKVL 74 Query: 175 KRVADEFDLAVISEIVTPAHIEEALDYIDVIQIGARNMQNFELLKAAGAVKKPVLLKRGL 234 K+V D F + +++I + E A +Y+D++QI A + +LL AA K + +K+G Sbjct: 75 KKVHDTFGVPTVTDIHSADEAEMAAEYVDILQIPAFLCRQTDLLVAAAKTGKTINIKKGQ 134 Query: 235 AATISEFINAAEYIMSQGNDQIILCERGIRT-YETATRNTLDISAVPILKQETHLPVFVD 293 + AA+ ++ GN ++L ERG Y+ +D +P + Q PV +D Sbjct: 135 FLSPLAMQFAADKVVEAGNKNVMLTERGTTFGYQDLV---VDYRGIPEM-QTFGYPVILD 190 Query: 294 VTHST-----------GRRDLLLPTAKAALAIGADGVMAEVHPDPSVALSDSAQQMAIPE 342 VTHS G L+ AKA +A+GADG+ E H +P+VA SD A + + Sbjct: 191 VTHSLQQPNQTSGVTGGMPQLIETVAKAGIAVGADGIFIETHENPAVAKSDGANMLKLDL 250 Query: 343 FEKWLNEL 350 E L +L Sbjct: 251 LEGLLTKL 258 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 266 Length adjustment: 27 Effective length of query: 331 Effective length of database: 239 Effective search space: 79109 Effective search space used: 79109 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory