Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate 352922 BT3395 putative acetylglutamate kinase (NCBI ptt file)
Query= curated2:A9A1K7 (267 letters) >FitnessBrowser__Btheta:352922 Length = 257 Score = 121 bits (303), Expect = 2e-32 Identities = 85/263 (32%), Positives = 137/263 (52%), Gaps = 30/263 (11%) Query: 1 MITIKIGGSVVDDLHPSTIADIKK--IAESEGVILVHGGGKEVTKVCEQLGKEPKFVTSP 58 + IK+GG +V++ +T+ + A S +LVHGGG+ TK+ QLG E K V Sbjct: 5 LTVIKVGGKIVEE--EATLLQLLNDFAAISGHKVLVHGGGRSATKIAAQLGIESKMVNG- 61 Query: 59 SGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKLLI 118 R TD ET ++ TMV G +NK IV LQ G+NA+GL+G D VI + ++ Sbjct: 62 ----RRITDAETLKVVTMVYGGLVNKNIVAGLQARGVNALGLTGADMNVIRSVKRP---- 113 Query: 119 VNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEESEFLNVDGDRAAAY 178 + +D G+ G + +V+AS + L+ +G+ PV++P+ + LN + D A Sbjct: 114 ------VKEVDYGFVGDVEKVDASLLADLIHKGVVPVMAPLTHDGQGNMLNTNADTIAGE 167 Query: 179 VAGKVGS---DKVLFITNVDGLLM----DDKVVPKLTLAEAKEIRPK--IGPGMEKKILA 229 A + + +++ G+L DD V+P++T AE ++ I GM K+ Sbjct: 168 TAKALSALFDVTLVYCFEKKGVLRDENDDDSVIPEITRAEFEQYVADGVIQGGMIPKLEN 227 Query: 230 STEALDMGVTTALI--ANGQKEN 250 S EA++ GVT +I A+ K+N Sbjct: 228 SFEAINAGVTEVVITLASAIKDN 250 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 257 Length adjustment: 25 Effective length of query: 242 Effective length of database: 232 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory