GapMind for Amino acid biosynthesis

 

Alignments for a candidate for proB in Bacteroides thetaiotaomicron VPI-5482

Align Glutamate 5-kinase; EC 2.7.2.11; Gamma-glutamyl kinase; GK (uncharacterized)
to candidate 353245 BT3719 glutamate 5-kinase (NCBI ptt file)

Query= curated2:Q8A1E7
         (360 letters)



>FitnessBrowser__Btheta:353245
          Length = 360

 Score =  703 bits (1814), Expect = 0.0
 Identities = 360/360 (100%), Positives = 360/360 (100%)

Query: 1   MKQEFTRIAVKVGSNVLARRDGTLDVTRMSALVDQIAELNKSGVEIILISSGAVASGRSE 60
           MKQEFTRIAVKVGSNVLARRDGTLDVTRMSALVDQIAELNKSGVEIILISSGAVASGRSE
Sbjct: 1   MKQEFTRIAVKVGSNVLARRDGTLDVTRMSALVDQIAELNKSGVEIILISSGAVASGRSE 60

Query: 61  IHPQKKLDSVDQRQLFSAVGQAKLINRYYELFREHGIAVGQVLTTKENFSTRRHYLNQKN 120
           IHPQKKLDSVDQRQLFSAVGQAKLINRYYELFREHGIAVGQVLTTKENFSTRRHYLNQKN
Sbjct: 61  IHPQKKLDSVDQRQLFSAVGQAKLINRYYELFREHGIAVGQVLTTKENFSTRRHYLNQKN 120

Query: 121 CMTVMLENGVIPIVNENDTISVSELMFTDNDELSGLIASMMDAQALIILSNIDGIYNGSP 180
           CMTVMLENGVIPIVNENDTISVSELMFTDNDELSGLIASMMDAQALIILSNIDGIYNGSP
Sbjct: 121 CMTVMLENGVIPIVNENDTISVSELMFTDNDELSGLIASMMDAQALIILSNIDGIYNGSP 180

Query: 181 SDPASAVIREIEHGKDLSNYIQATKSSFGRGGMLTKTNIARKVADEGITVIIANGKRDNI 240
           SDPASAVIREIEHGKDLSNYIQATKSSFGRGGMLTKTNIARKVADEGITVIIANGKRDNI
Sbjct: 181 SDPASAVIREIEHGKDLSNYIQATKSSFGRGGMLTKTNIARKVADEGITVIIANGKRDNI 240

Query: 241 LVDLLQQPDDTVCTRFIPSTEAVSSVKKWIAHSEGFAKGEIHINECATDILSSEKAASIL 300
           LVDLLQQPDDTVCTRFIPSTEAVSSVKKWIAHSEGFAKGEIHINECATDILSSEKAASIL
Sbjct: 241 LVDLLQQPDDTVCTRFIPSTEAVSSVKKWIAHSEGFAKGEIHINECATDILSSEKAASIL 300

Query: 301 PVGITHIEGEFEKDDIVRIMDFLGNQVGVGKANCDSAQAREAMGKHGKKPVVHYDYLYIE 360
           PVGITHIEGEFEKDDIVRIMDFLGNQVGVGKANCDSAQAREAMGKHGKKPVVHYDYLYIE
Sbjct: 301 PVGITHIEGEFEKDDIVRIMDFLGNQVGVGKANCDSAQAREAMGKHGKKPVVHYDYLYIE 360


Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 578
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 360
Length of database: 360
Length adjustment: 29
Effective length of query: 331
Effective length of database: 331
Effective search space:   109561
Effective search space used:   109561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate 353245 BT3719 (glutamate 5-kinase (NCBI ptt file))
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))

Software error:

../bin/blast/fastacmd -i /tmp/list.1721.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.1721.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.