GapMind for Amino acid biosynthesis

 

Aligments for a candidate for thrC in Bacteroides thetaiotaomicron VPI-5482

Align threonine synthase; EC 4.2.3.1 (characterized)
to candidate 351929 BT2401 threonine synthase (NCBI ptt file)

Query= CharProtDB::CH_002114
         (428 letters)



>lcl|FitnessBrowser__Btheta:351929 BT2401 threonine synthase (NCBI
           ptt file)
          Length = 433

 Score =  353 bits (907), Expect = e-102
 Identities = 192/432 (44%), Positives = 271/432 (62%), Gaps = 6/432 (1%)

Query: 1   MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS 60
           MK Y+        S  +AV +GL  ++GLF P  +        D +  L F   + ++  
Sbjct: 1   MKYYSTNKQAPMASLQEAVVKGLAADRGLFMPMTIKPLPQEFYDTIDTLSFQEIAYRVAD 60

Query: 61  AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH 120
           AF G++IP + L++ V    +F  P+  V  ++  LELFHGPTLAFKD GGRFMA++L +
Sbjct: 61  AFFGEDIPTDTLKQIVYDTLSFDVPLVKVADNIYSLELFHGPTLAFKDVGGRFMARLLGY 120

Query: 121 IA---GDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNI 177
                G K V +L ATSGDTG+AVA+ F G+  + V +LYP+GK+S +QEK F TLG NI
Sbjct: 121 FIKKEGQKDVNVLVATSGDTGSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNI 180

Query: 178 ETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQET 237
             + +DG FD CQALVK AF D+EL   L L SANSIN++R L Q  YYF A AQL +  
Sbjct: 181 TALEVDGTFDDCQALVKAAFMDKELNEHLSLTSANSINVARFLPQAFYYFYAYAQLKRAG 240

Query: 238 R-NQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQAT 296
           + +  V+ VPSGNFG++TAGL  K +GLPVKRFIAA N ND   ++L  G+++P+ + AT
Sbjct: 241 KADNAVICVPSGNFGNITAGLFGKKMGLPVKRFIAANNRNDIFYQYLQTGKYNPRPSVAT 300

Query: 297 LSNAMDVSQPNNWPRVEELFRRKIWQLK-ELGYAAVDDETTQQTMREL-KELGYTSEPHA 354
           ++NAMDV  P+N+ RV +L+      +  E+      DE  ++T++E  KE  Y  +PH 
Sbjct: 301 IANAMDVGDPSNFARVLDLYGGSHADISAEISGTTYTDEQIRETVKETWKEHHYLLDPHG 360

Query: 355 AVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLP 414
           A  YRAL++ L  GE G+FL TAHPAKF E+VE+I+GE +++P +L E       S  + 
Sbjct: 361 ACGYRALQEGLKQGETGVFLETAHPAKFLETVESIIGEAVEIPAKLQEFMKGEKKSLQMT 420

Query: 415 ADFAALRKLMMN 426
            +FA  +K +++
Sbjct: 421 KEFADFKKYLLS 432


Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 476
Number of extensions: 25
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 428
Length of database: 433
Length adjustment: 32
Effective length of query: 396
Effective length of database: 401
Effective search space:   158796
Effective search space used:   158796
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate 351929 BT2401 (threonine synthase (NCBI ptt file))
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00260.hmm
# target sequence database:        /tmp/gapView.20128.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00260  [M=340]
Accession:   TIGR00260
Description: thrC: threonine synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    2.3e-96  308.8   0.0    3.2e-96  308.4   0.0    1.0  1  lcl|FitnessBrowser__Btheta:351929  BT2401 threonine synthase (NCBI 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Btheta:351929  BT2401 threonine synthase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  308.4   0.0   3.2e-96   3.2e-96      12     335 ..      66     399 ..      56     403 .. 0.92

  Alignments for each domain:
  == domain 1  score: 308.4 bits;  conditional E-value: 3.2e-96
                          TIGR00260  12 ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne...tvlcAtsGdt 84 
                                        +++  +l++ ++ ++ ++ +  +v   n+y +elfhgPtlaFKD+g++f+a ll ++ ++  +    vl+AtsGdt
  lcl|FitnessBrowser__Btheta:351929  66 DIPTDTLKQIVYDTLSFDVPLVKVAD-NIYSLELFHGPTLAFKDVGGRFMARLLGYFIKKEGQkdvNVLVATSGDT 140
                                        578889999***************99.****************************985543333779********* PP

                          TIGR00260  85 gaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeifedke...klklnsvNs 157
                                        g+a+a+++ g ++++v+vLyPkgk+s ++ek +t+l +n++ l+++G+FDd+q+lvk++f dke   +l l s+Ns
  lcl|FitnessBrowser__Btheta:351929 141 GSAVANGFLGVEGIHVYVLYPKGKVSEIQEKQFTTLGQNITALEVDGTFDDCQALVKAAFMDKElneHLSLTSANS 216
                                        ************************************************************988778799******* PP

                          TIGR00260 158 inparieaqktyafeiveqlgk.espdkvvvpvpsgnfgailkGflekkelglpieklaiaaegaadivrrflksg 232
                                        in+ar + q  y+f + +ql++  + d+ v+ vpsgnfg+i++G + kk++ lp  k++iaa++ +di  ++l++g
  lcl|FitnessBrowser__Btheta:351929 217 INVARFLPQAFYYFYAYAQLKRaGKADNAVICVPSGNFGNITAGLFGKKMG-LP-VKRFIAANNRNDIFYQYLQTG 290
                                        **********77777888887758899******************999999.**.9******************** PP

                          TIGR00260 233 dlepkedkeTlstAmdignpsnveralelarrslgnled..lkesvsdeeileaikklaeeegyllephtavavaa 306
                                        +  p+ +++T+++Amd+g psn+ r+l+l   s +++ +   +++ +de+i e++k+  +e++yll+ph+a +++a
  lcl|FitnessBrowser__Btheta:351929 291 KYNPRPSVATIANAMDVGDPSNFARVLDLYGGSHADISAeiSGTTYTDEQIRETVKETWKEHHYLLDPHGACGYRA 366
                                        ****************************887777766551156699****************************** PP

                          TIGR00260 307 lkklvekg.vs...atadpaKFeevvealtgnk 335
                                        l++ +++g ++    ta+paKF e+ve + g+ 
  lcl|FitnessBrowser__Btheta:351929 367 LQEGLKQGeTGvflETAHPAKFLETVESIIGEA 399
                                        ******997446789************998875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (340 nodes)
Target sequences:                          1  (433 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 12.47
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory