GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argE in Paraburkholderia bryophila 376MFSha3.1

Align Acetylornithine deacetylase; AO; Acetylornithinase; EC 3.5.1.16; N-acetylornithinase; NAO (uncharacterized)
to candidate H281DRAFT_00879 H281DRAFT_00879 acetylornithine deacetylase

Query= curated2:O68873
         (380 letters)



>FitnessBrowser__Burk376:H281DRAFT_00879
          Length = 416

 Score =  182 bits (462), Expect = 1e-50
 Identities = 128/388 (32%), Positives = 193/388 (49%), Gaps = 20/388 (5%)

Query: 2   SDTLPALRATLTELVAMDTTSFRPNVPLIDYAQARLEAAGFSAERQKFLDDAGVEKVNLV 61
           S T P     +T LV+MDT S  PN+ LI+  +  L A G          DA  +  NL 
Sbjct: 23  SGTTPVSLPWVTRLVSMDTVSRNPNLGLIETVRDELRALGIEGT---LTHDASGKWANLF 79

Query: 62  A-VKGGSGSGRAALALVGHSDCVPYDAA-W-TDALRLTEKDGRLYARGACDTKGFIACAL 118
           A +    G     + L GH+D VP D   W +D  +   +  +LY RG CD KGFI  AL
Sbjct: 80  ATIPAHDGETNGGVVLSGHTDVVPVDGQQWDSDPFKPEIRGDKLYGRGTCDMKGFIGAAL 139

Query: 119 HAALNAEQLKA--PLMVVLTADEEVGLTGAKKLVEAGLGRARH---AIVGEPTRLIPVRA 173
               + ++ K   P+   L+ DEEVG  GA  L+   + R       IVGEPT + P+ A
Sbjct: 140 ALVPDMQRTKLAKPIHFALSFDEEVGCAGAPLLIADLMKRGVKPDGCIVGEPTSMRPIVA 199

Query: 174 NKGYCLAEVEVRGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTVLRED--LDEGFQPPF 231
           +KG    +  VRG+  HS+    G +AI  A R +  +  +A    RE    DE +  PF
Sbjct: 200 HKGINAYQCCVRGQAAHSSLTPKGLNAIEYAARLICYIRDMA-DQFREQGPFDELYDVPF 258

Query: 232 TTVNVGVIQGGKAKNVIPGACRFVVEWRPIPGQPPE----RVSQLL-ETIRQELVRDEPA 286
           TT     I GG A N +P  C+F  E+R +P   PE    R+ Q   ET+  +++R+ P 
Sbjct: 259 TTAQTSTIVGGNAINTVPAECKFQFEFRNLPTLDPEPIFARIDQYARETLLPKMLREHPL 318

Query: 287 FEAQIRVVRTDRGVNTRADAEVVRFLAEASGNAPET-VSFGTEAPQMTELGAEAVVFGPG 345
              +I  +    G+++   A + + +   + +  +  V++GTEA   +  G  ++V GPG
Sbjct: 319 AAIEITKIAAAPGLDSSEQAAITQLVRALTADQDKRKVAYGTEAGLFSLAGIPSIVCGPG 378

Query: 346 DIRVAHQTGEYVPVEDLVRCEAVLARAV 373
           DI+ AH+  E+V ++ LV+CE  L + +
Sbjct: 379 DIQQAHKANEFVALDQLVQCERFLHKFI 406


Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 361
Number of extensions: 15
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 380
Length of database: 416
Length adjustment: 31
Effective length of query: 349
Effective length of database: 385
Effective search space:   134365
Effective search space used:   134365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate H281DRAFT_00879 H281DRAFT_00879 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))

Software error:

../bin/blast/fastacmd -i /tmp/list.19153.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.19153.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.