Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate H281DRAFT_02805 H281DRAFT_02805 fructose-bisphosphate aldolase
Query= BRENDA::L0HLF8 (394 letters) >FitnessBrowser__Burk376:H281DRAFT_02805 Length = 339 Score = 348 bits (892), Expect = e-100 Identities = 186/334 (55%), Positives = 231/334 (69%), Gaps = 2/334 (0%) Query: 50 ELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEVNRQAYRQLLLTTPGLGEYIS 109 EL T ++ PG+G+LA DES T KR +IGLD+TE NR+AYR LLLTTPGLGE++S Sbjct: 6 ELQATVDAMVQPGKGLLAADESGPTIAKRFKTIGLDSTEENRRAYRNLLLTTPGLGEFVS 65 Query: 110 GAILFEETLYQSTTDGKKFADCLRDENIVPGIKVDKGLVPLPGSNNESWCQGLDGLASRS 169 G IL+EETL Q +G F + IVPGIKVD G VPL + + +GLDGLA R Sbjct: 66 GVILYEETLGQKADNGTPFPEVAAKNGIVPGIKVDLGKVPLAHAPGDEITEGLDGLARRF 125 Query: 170 AEYYKQGARFAKWRTVVSIPCG-PSALAVKEAAWGLARYAGISQDNGLVPIVEPEILLDG 228 +Y KQGARFAKWR V +I PS LA++ A LARYA I+Q+ G+VPIVEPE+L+DG Sbjct: 126 VDYKKQGARFAKWRAVYNITANLPSRLAIEANADSLARYAAIAQEAGIVPIVEPEVLMDG 185 Query: 229 DHPIDRTLEVAERVWAEVFYYLAENNVMFEGILLKPSMVTPGAEHKEKASPDTIAKYTLT 288 DH I+R+ EV E V EVF L + V+ E +LLKPSMV G+E ++S IA YT+ Sbjct: 186 DHTIERSAEVTEAVLHEVFVALQRHRVVLEHMLLKPSMVIAGSESARQSSTADIAAYTVR 245 Query: 289 MLKRRVPPAVPGIMFLSGGQSEMEATLNLNAMNQ-SPNPWHVSFSYARALQNSVLKTWQG 347 +LKR VP AVPGI+FLSGGQS EAT NL+AMN+ P PW++SFSY RALQ L+ W+G Sbjct: 246 ILKRTVPAAVPGIVFLSGGQSPEEATANLDAMNRLGPLPWNLSFSYGRALQEPPLQAWKG 305 Query: 348 SPENVEAAQKALLARAKANSLAQLGSYSANDESD 381 + NVE AQ+ALL RA+ NS A LG Y A E + Sbjct: 306 AASNVEEAQQALLKRARLNSAAALGKYDAAQEKN 339 Lambda K H 0.314 0.130 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 339 Length adjustment: 30 Effective length of query: 364 Effective length of database: 309 Effective search space: 112476 Effective search space used: 112476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory