Align Glutamyl-tRNA(Gln) amidotransferase subunit D; Glu-ADT subunit D; EC 6.3.5.- (uncharacterized)
to candidate H281DRAFT_00783 H281DRAFT_00783 L-asparaginase
Query= curated2:Q18GL3 (442 letters) >FitnessBrowser__Burk376:H281DRAFT_00783 Length = 361 Score = 107 bits (266), Expect = 8e-28 Identities = 109/350 (31%), Positives = 161/350 (46%), Gaps = 46/350 (13%) Query: 87 TSKSAASAVAFDESLPTVSLISTGGTIA-------STVDYRTGAVTAQFDAEDVLRAVPD 139 TS S+ A A LP +++++TGGTIA +T Y+ G V E +L VP Sbjct: 23 TSSSSPGAAAL---LPRIAVLATGGTIAGAAADATNTSGYQAGVV----GVEQLLAVVPA 75 Query: 140 LAGRANYRGRVVRNILSENMTPAVWQDLA----AAVADEIRAGADGVVVMHGTDTMQYSA 195 L+ A + ++ S++M +W LA A +AD+ DGVVV HGTDT++ +A Sbjct: 76 LSTVARIAPEQIASVDSKDMAMPLWTALAQRINALLADD---DIDGVVVTHGTDTLEETA 132 Query: 196 SALSYMLDTPVPVVFTGSQRSADRPSSD---NVMNAVCAVEAATADISGVFVCMHASTAD 252 L + + PVV T + R A S+D N++NAV A A GV V + Sbjct: 133 YLLHLTVKSDKPVVLTAAMRPASALSADGPLNLLNAVTVAANAGARGQGVLVAFNNK--- 189 Query: 253 DTCALHRGTRVRKNHTSRRDAFKT-----VGATPIGKIEYDTETVSFHRDHAARESTELN 307 +H V K T DAF++ +G G++E+ V R H STE Sbjct: 190 ----IHSARDVVKTSTYAVDAFQSPEVGALGWVQDGRVEFQRSVV---RPHTL--STEFV 240 Query: 308 LTSELNEDVMLLTFTPGMNIDRQTAFLTDSTPDGLIIAGTGLGHVHTEFIPTVAELVADG 367 + + V ++ G++ A +T G+++AGTG G +H +A+ + G Sbjct: 241 IGANW-PHVDIVASYAGVSRIAVDALVTAGV-RGIVVAGTGNGSIHASLTQALADAASQG 298 Query: 368 VVVAMTSQCIEGRVCDRVYDTGRDLLEAGVVEAGDTLPGTAKVKLMWALA 417 V V +S+ G V R D L G V AG P A+V LM ALA Sbjct: 299 VAVVRSSRVGSGHVM-RNGAAADDAL--GFVSAGSLNPYKARVLLMVALA 345 Lambda K H 0.315 0.129 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 361 Length adjustment: 31 Effective length of query: 411 Effective length of database: 330 Effective search space: 135630 Effective search space used: 135630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory