Align Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 (characterized)
to candidate H281DRAFT_01081 H281DRAFT_01081 L-glutamine synthetase
Query= SwissProt::Q60182 (454 letters) >FitnessBrowser__Burk376:H281DRAFT_01081 Length = 444 Score = 201 bits (512), Expect = 3e-56 Identities = 147/457 (32%), Positives = 223/457 (48%), Gaps = 35/457 (7%) Query: 14 EYVKKNNVKFIRFQFVDILGFPKNVAYPVKAGEKGIEELREIFE------NGVWFDGSSI 67 E++KKN+V I D+ G + P E G E +R G + DG ++ Sbjct: 6 EFLKKNHVTEIEAIIPDMAGIARGKIIPRSKFESG-ESMRLPQAVMIQTVTGDYPDGGTL 64 Query: 68 TGFVGIEESDMLLKPDLSTLSVLPWRPEEKSVARVICDVYKDEKTPFEGDPRSRLKAILE 127 TG + + DM+ PD ST+ ++PW + A+VI D + TP PR L+ +LE Sbjct: 65 TG---VTDPDMVCVPDSSTIRMIPWAVDP--TAQVIHDCVHFDGTPVAISPRRVLRRVLE 119 Query: 128 ELKKEMNGEYFVGPEPEFFL--LKRDPHNP-----HRWVPADDGGY-FDVEPLDDAPDIR 179 L K + + PE EF+L + +DP P R A+ G + +E +++ + Sbjct: 120 -LYKAKGWKPVIAPELEFYLVDMNKDPDLPLQPPIGRTGRAETGRQAYSIEAVNEFDPLF 178 Query: 180 RDIVLALENLGFHVEASHHEVAPGQHEVDFKFDNALKTADSVITFKMTIKNIAKKHGLKA 239 DI + V+ HEV Q E++F + LK ADSV FK T++ A +H + A Sbjct: 179 EDIYEYCDVQELEVDTLIHEVGAAQMEINFMHGDPLKLADSVFLFKRTVREAALRHKMYA 238 Query: 240 TFMPKPFFGMNGNGMHCHQSV--WFNGEPSFYDPEGPYNGLSETCLSYIAGILSHAKALV 297 TFM KP G G+ MH HQS+ G F +G L SYIAG+ + AL+ Sbjct: 239 TFMAKPMEGEPGSAMHMHQSLVDGRTGHNLFTGADGKPTSLFT---SYIAGLQKYTPALM 295 Query: 298 AITNPTVNSYKRLVPGYEAPVNIAWANKNRSAIIRVPAARGKATRIEFRAPDPTCNPYLA 357 I P +NSY+RL AP+N+AW NR+ R+P + A RIE R P CNPYLA Sbjct: 296 PIFAPYINSYRRLSRFMAAPINVAWGYDNRTVGFRIPHSGPAARRIENRIPGVDCNPYLA 355 Query: 358 FACMLAAGLDGIKKKMTAPEPVERNIFKMSEEEKKQLGIESVPANLAAALDELECDEVLQ 417 A LAAG G+ +K+ A EP+ + +++ + +P NL L + E + Sbjct: 356 IAATLAAGYLGMTQKLDATEPLLSDGYELPYQ---------LPRNLEEGLTLMGACEPIA 406 Query: 418 KALGKHIYENYMEIKRAEWDDFRTAVTDWETGKYLIY 454 + LG + Y+ +K E++ F ++ WE L++ Sbjct: 407 EVLGDKFVQAYLALKETEYEAFFRVISSWERRHLLLH 443 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 444 Length adjustment: 33 Effective length of query: 421 Effective length of database: 411 Effective search space: 173031 Effective search space used: 173031 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory