GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisA in Paraburkholderia bryophila 376MFSha3.1

Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate H281DRAFT_05658 H281DRAFT_05658 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase

Query= curated2:A1TKZ3
         (248 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_05658 H281DRAFT_05658
           1-(5-phosphoribosyl)-5-[(5-
           phosphoribosylamino)methylideneamino]
           imidazole-4-carboxamide isomerase
          Length = 250

 Score =  407 bits (1047), Expect = e-119
 Identities = 197/244 (80%), Positives = 221/244 (90%)

Query: 1   MLLIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMARKWVDAGARRLHLVDLNGAFAGAP 60
           MLLIPAIDLKDG CVRLKQGDMDQ+T F E+PAAMAR WV+ GARRLHLVDLNGAFAG P
Sbjct: 1   MLLIPAIDLKDGQCVRLKQGDMDQATIFSEEPAAMARHWVERGARRLHLVDLNGAFAGKP 60

Query: 61  KNHAAIKAILKEVGDDLPVQLGGGIRDLDTIEKYIDGGLRYVIIGTAAVKNPGFLKDACS 120
           +N  AI+AI++EVG ++PVQLGGGIRDL+TIE+Y+D GL YVIIGTAAVKNPGFL+DAC+
Sbjct: 61  RNEEAIRAIIEEVGGEIPVQLGGGIRDLNTIERYLDDGLEYVIIGTAAVKNPGFLQDACT 120

Query: 121 AFGGHIIVGLDAKDGKVATDGWSKLTGHEVVDLAKRFEDWGVESIVYTDIGRDGMLSGIN 180
           AFGGHIIVGLDAKDGKVATDGWSKLTGHEV DLA++FED+G ESI+YTDIGRDGML GIN
Sbjct: 121 AFGGHIIVGLDAKDGKVATDGWSKLTGHEVADLARKFEDYGCESIIYTDIGRDGMLQGIN 180

Query: 181 IEATVKLAQALTIPVIASGGLAGMADIEQLCAVESEGVEGVICGRAIYSGDLDFAAAQAR 240
           IEATV+LA+A+ IPVIASGGL+ + DIE LC VE EG+EGVICGRAIYSGDLDFAAAQ  
Sbjct: 181 IEATVRLARAVKIPVIASGGLSNLTDIESLCEVEDEGIEGVICGRAIYSGDLDFAAAQTL 240

Query: 241 ADEL 244
           AD L
Sbjct: 241 ADRL 244


Lambda     K      H
   0.319    0.139    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 333
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 248
Length of database: 250
Length adjustment: 24
Effective length of query: 224
Effective length of database: 226
Effective search space:    50624
Effective search space used:    50624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

Align candidate H281DRAFT_05658 H281DRAFT_05658 ( 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase)
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00007.hmm
# target sequence database:        /tmp/gapView.28029.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00007  [M=231]
Accession:   TIGR00007
Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    2.8e-82  261.8   0.2    3.2e-82  261.6   0.2    1.0  1  lcl|FitnessBrowser__Burk376:H281DRAFT_05658  H281DRAFT_05658  1-(5-phosphorib


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Burk376:H281DRAFT_05658  H281DRAFT_05658  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  261.6   0.2   3.2e-82   3.2e-82       1     229 [.       3     235 ..       3     237 .. 0.97

  Alignments for each domain:
  == domain 1  score: 261.6 bits;  conditional E-value: 3.2e-82
                                    TIGR00007   1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikk 66 
                                                  +iPaiDlk+G++vrl qGd+d+ t++s++p+++a+++ e ga++lH+VDL+gA++g+++n+e+i+ 
  lcl|FitnessBrowser__Burk376:H281DRAFT_05658   3 LIPAIDLKDGQCVRLKQGDMDQATIFSEEPAAMARHWVERGARRLHLVDLNGAFAGKPRNEEAIRA 68 
                                                  59**************************************************************** PP

                                    TIGR00007  67 iveel..evkvqvGGGiRsleavekllelgverviigtaavenpelvkellkelgsekivvslDak 130
                                                  i+ee+  e++vq+GGGiR+l+++e++l+ g+e+viigtaav+np +++++ +++g  +i+v+lDak
  lcl|FitnessBrowser__Burk376:H281DRAFT_05658  69 IIEEVggEIPVQLGGGIRDLNTIERYLDDGLEYVIIGTAAVKNPGFLQDACTAFG-GHIIVGLDAK 133
                                                  ***99445789********************************************.99******** PP

                                    TIGR00007 131 egevavkGWkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvkeaeveviasG 196
                                                  +g+va+ GW + +  ++++la+k+e++g+e+ii+Tdi +dG+l+G+n+e+t +l+++++++viasG
  lcl|FitnessBrowser__Burk376:H281DRAFT_05658 134 DGKVATDGWSKLTGHEVADLARKFEDYGCESIIYTDIGRDGMLQGINIEATVRLARAVKIPVIASG 199
                                                  ****************************************************************** PP

                                    TIGR00007 197 Gvssiedvkalkk...lgvkgvivGkAlyegklklk 229
                                                  G s+ +d+++l +    g++gvi+G+A+y+g+l++ 
  lcl|FitnessBrowser__Burk376:H281DRAFT_05658 200 GLSNLTDIESLCEvedEGIEGVICGRAIYSGDLDFA 235
                                                  *********998877799**************9976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (231 nodes)
Target sequences:                          1  (250 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 6.04
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory