Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate H281DRAFT_00143 H281DRAFT_00143 L-threonine O-3-phosphate decarboxylase
Query= curated2:A5UA19 (352 letters) >FitnessBrowser__Burk376:H281DRAFT_00143 Length = 368 Score = 74.7 bits (182), Expect = 4e-18 Identities = 67/225 (29%), Positives = 102/225 (45%), Gaps = 17/225 (7%) Query: 31 LNANEYPTSPKFQLSGKDLNRYPEPQPQRVVQAYANYAGVSTENVLVTRGGDEGIELIIH 90 +N + YP P + R P+ A Y +VL G I + Sbjct: 61 INPHGYPVPP---VPADAWRRLPDEGDDLAECAARYYGAPDAAHVLSVAGSQAAIRTLPA 117 Query: 91 TFCEPKQDAILFCPPTYGMYAVSAETAGVLSKTVPLTDDFQLNLPEIKNHLNDVKVVFVC 150 P+ A + P TY YA + + AG + VPL + + LP+ H V V Sbjct: 118 LL--PRAVAGV-APLTYSEYAPAFQRAG--HRVVPLDVSWDV-LPDSLTH------VAVV 165 Query: 151 SPNNPTGNLLKQSDILDL-LQITAGKAIVVVDEAYIEFCPEASVINLLKNYPHLAIIRTL 209 +PNNPT L S +L Q++A ++VDEA+ + P+AS+ + L ++R+ Sbjct: 166 NPNNPTAGHLSASKLLAWHAQLSARGGTLLVDEAFADTMPDASLA-AFTDRDGLIVLRSP 224 Query: 210 SKAFALAGLRCGFVLANPELIDILSKVIAPYPIPVPSADLAEQAL 254 K F LAG+R GFVLA P L+D L +V+ + + P+ AL Sbjct: 225 GKFFGLAGVRAGFVLAAPALLDSLRRVLGAWTVSGPARHAVRAAL 269 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 368 Length adjustment: 29 Effective length of query: 323 Effective length of database: 339 Effective search space: 109497 Effective search space used: 109497 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory