Align Histidinol-phosphate aminotransferase 2; EC 2.6.1.9; Imidazole acetol-phosphate transaminase 2 (uncharacterized)
to candidate H281DRAFT_01942 H281DRAFT_01942 histidinol-phosphate aminotransferase
Query= curated2:Q62FC0 (356 letters) >FitnessBrowser__Burk376:H281DRAFT_01942 Length = 359 Score = 532 bits (1370), Expect = e-156 Identities = 265/356 (74%), Positives = 301/356 (84%) Query: 1 MSRYWSDIVRQLEPYVPGEQPALAHPVKLNTNENPYPPSPRALDAIRRELGDTGEALRRY 60 +SRYWSDIV +L PYVPGEQP LA PVKLNTNENPYPPSPR L+AIR+ELGD GE+LRRY Sbjct: 1 LSRYWSDIVHRLTPYVPGEQPLLARPVKLNTNENPYPPSPRVLEAIRQELGDAGESLRRY 60 Query: 61 PDPVARRLRETVAAYHGIAPEQVFAGNGSDEVLAHAFQALLQHDRPLRFPDITYSFYPTY 120 PDP A +LRETVAAYHGI +QVFAGNGSDEVLA FQALL+HD+PL FPDITYSFYPTY Sbjct: 61 PDPTAFKLRETVAAYHGIRADQVFAGNGSDEVLALTFQALLKHDKPLLFPDITYSFYPTY 120 Query: 121 ARLYRVAYETVPLAGDFSIVVDDYLDDAGCVLFPNPNAPTGRALPLADIERIVAANPSSV 180 ARL+ V Y+T+PL F+I VDDY G +LFPNPNAPTGR LPLADIER+V + SV Sbjct: 121 ARLFEVDYQTIPLDDSFAINVDDYAIANGGILFPNPNAPTGRPLPLADIERLVKKSADSV 180 Query: 181 VVIDEAYVDFGAESAVSLIARYPNLLVVHTVSKARSLAGMRVGFAFGDAALIDALTRVKD 240 VVIDEAYVDFGAESA+ LI RYPNLLVV TVSK+RSLAGMRVGFAFG+A LIDAL RVKD Sbjct: 181 VVIDEAYVDFGAESAIGLIDRYPNLLVVQTVSKSRSLAGMRVGFAFGNAELIDALNRVKD 240 Query: 241 SFNSYPLDRLAQVATQASYEDEAWFQATRKQVIASRERLVGALAALGFDVVPSAANFVFA 300 SFNSYPLDRLAQVA +A+YED+ WF+ T +VIASRERL L ALGFDVVPSAAN +FA Sbjct: 241 SFNSYPLDRLAQVAARAAYEDDRWFRDTCAKVIASRERLSAGLTALGFDVVPSAANLLFA 300 Query: 301 RPRSHDAATLAAQLKQREIFVRHFKLPRIDQHLRITVGSDAECDALVAALRELLAA 356 R ++DAA L + L++REIFVRHF PRIDQHLRI+VG+DAEC L+ ALR++ +A Sbjct: 301 RHEAYDAAMLVSLLREREIFVRHFNAPRIDQHLRISVGTDAECGVLLDALRDIFSA 356 Lambda K H 0.322 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 359 Length adjustment: 29 Effective length of query: 327 Effective length of database: 330 Effective search space: 107910 Effective search space used: 107910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_01942 H281DRAFT_01942 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.12366.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-93 299.6 0.0 1.5e-93 299.4 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_01942 H281DRAFT_01942 histidinol-phosp Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_01942 H281DRAFT_01942 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 299.4 0.0 1.5e-93 1.5e-93 4 349 .] 9 353 .. 6 353 .. 0.94 Alignments for each domain: == domain 1 score: 299.4 bits; conditional E-value: 1.5e-93 TIGR01141 4 ikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk....klhrYpdpqalelkeala 65 ++ l+pY+pg++ l vkLn+nEnP++ps++v+ea+++el +l+rYpdp a++l+e++a lcl|FitnessBrowser__Burk376:H281DRAFT_01942 9 VHRLTPYVPGEQPLLA-RPVKLNTNENPYPPSPRVLEAIRQELGdageSLRRYPDPTAFKLRETVA 73 7889*****9888777.5*************************888889***************** PP TIGR01141 66 kylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqe 131 +y g+ ++++++gnGsde++ l ++a+l+ + l+++ tys Y+++a++ +++++++pl++++ lcl|FitnessBrowser__Burk376:H281DRAFT_01942 74 AYHGIRADQVFAGNGSDEVLALTFQALLKHDKPLLFPDITYSFYPTYARLFEVDYQTIPLDDSFAI 139 ***************************************************************988 PP TIGR01141 132 dleavleaakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlella 197 ++++ + a + + + +Pn+PtG l ++ie+++++++d +VV+DeAY++F e s++ l+ lcl|FitnessBrowser__Burk376:H281DRAFT_01942 140 NVDDYAIA-NG---GILFPNPNAPTGRPLPLADIERLVKKSADSVVVIDEAYVDFGAE-SAIGLID 200 99888832.22...35679*********************99***************7.******* PP TIGR01141 198 eypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapyn...vsslaleaavaalrdsdkie 260 +ypnl+v++T+SK+ +LAg+RvG+a++nae+i+al++v++++n +++la+ aa aa++d++ ++ lcl|FitnessBrowser__Burk376:H281DRAFT_01942 201 RYPNLLVVQTVSKSRSLAGMRVGFAFGNAELIDALNRVKDSFNsypLDRLAQVAARAAYEDDRWFR 266 ***************************************87543339******************* PP TIGR01141 261 ktveevkkererlleelkkleglevyeSkaNFvlikvke.daeelleallekgiivRdlksaegll 325 +t ++v+++rerl ++l++l g++v++S aN ++++ ++ da+ l+ l e++i vR++++ + lcl|FitnessBrowser__Burk376:H281DRAFT_01942 267 DTCAKVIASRERLSAGLTAL-GFDVVPSAANLLFARHEAyDAAMLVSLLREREIFVRHFNAP--RI 329 ********************.8**************99999******************944..68 PP TIGR01141 326 eeclRitvGtreenerllealkei 349 +++lRi+vGt+ e+ ll+al++i lcl|FitnessBrowser__Burk376:H281DRAFT_01942 330 DQHLRISVGTDAECGVLLDALRDI 353 ********************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.83 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory