GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisC in Paraburkholderia bryophila 376MFSha3.1

Align Histidinol-phosphate aminotransferase 1; EC 2.6.1.9; Imidazole acetol-phosphate transaminase 1 (uncharacterized)
to candidate H281DRAFT_03924 H281DRAFT_03924 histidinol-phosphate aminotransferase

Query= curated2:Q46Y48
         (376 letters)



>FitnessBrowser__Burk376:H281DRAFT_03924
          Length = 370

 Score =  563 bits (1452), Expect = e-165
 Identities = 278/363 (76%), Positives = 317/363 (87%)

Query: 13  FGPDYVRAISPYIAGKPISEVAREFGLDEAGIVKLASNENPLGMPESAKHAAAAAIAELG 72
           FGP YVRAI+PYIAGKPISEVAREFGLDEA IVKLASNENPLGMPESAK A A A +ELG
Sbjct: 5   FGPSYVRAIAPYIAGKPISEVAREFGLDEANIVKLASNENPLGMPESAKRAMAQAASELG 64

Query: 73  RYPDSNGFELKAALSTKLGVPQDWLTLGNGSNDILELAAHALVTPGQSIVYAEYSFAVYA 132
           RYPD+N FELKAALS + GVP DW+TLGNGSNDILE+AAHA V  GQSI+YA+YSFAVYA
Sbjct: 65  RYPDANAFELKAALSERYGVPSDWITLGNGSNDILEIAAHAFVEKGQSIIYAQYSFAVYA 124

Query: 133 LATQEIGARAIVVKARDYGHDLDAMAAAITSDTRLVFIANPNNPTGTFVPAAALETFLAK 192
           LATQ +GARAIVV A +YGHDLDAM AAIT DTRL+F+ANPNNPTGTF+  + LE FL K
Sbjct: 125 LATQGLGARAIVVPAVEYGHDLDAMLAAITDDTRLIFVANPNNPTGTFIEGSKLEAFLDK 184

Query: 193 VPAEVVVVLDEAYNEYLDDDQQYDSVAWVRRYPNLLVSRTFSKAYGLAGLRIGYAVAQPE 252
           VP  V VVLDEAY EYL  +++YDS+ WVRRYP+LLVSRTFSKA+GLAGLR+G+A+AQPE
Sbjct: 185 VPRNVAVVLDEAYTEYLPAEKRYDSIEWVRRYPSLLVSRTFSKAFGLAGLRVGFAIAQPE 244

Query: 253 LTDLLNRIRQPFNVNSVAQAAAVAALGDTAFLQRSAELNRAGKAQLVEAFSRLGLEFVAS 312
           LTDLLNR+RQPFNVN++AQAAA+AAL D AFL++SA LN  G  +L EAF +LGLE+V S
Sbjct: 245 LTDLLNRLRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFEKLGLEYVPS 304

Query: 313 SGNFVLVRVGDDDDAGARVNVALLRQGVIVRPVGNYGMPRWLRVTIGLPDENAAFIAALE 372
            GNFVLVRVG+DD AG RVN+ LL+QGVIVRPVGNYG+P+WLRVTIGLP+EN AFIAALE
Sbjct: 305 DGNFVLVRVGNDDAAGNRVNIELLKQGVIVRPVGNYGLPQWLRVTIGLPEENEAFIAALE 364

Query: 373 RAL 375
           + L
Sbjct: 365 KTL 367


Lambda     K      H
   0.318    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 578
Number of extensions: 19
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 376
Length of database: 370
Length adjustment: 30
Effective length of query: 346
Effective length of database: 340
Effective search space:   117640
Effective search space used:   117640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate H281DRAFT_03924 H281DRAFT_03924 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))

Software error:

../bin/blast/fastacmd -i /tmp/list.30231.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.30231.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.