Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate H281DRAFT_05880 H281DRAFT_05880 Aspartate/methionine/tyrosine aminotransferase
Query= curated2:Q970Z4 (357 letters) >FitnessBrowser__Burk376:H281DRAFT_05880 Length = 374 Score = 79.7 bits (195), Expect = 1e-19 Identities = 55/180 (30%), Positives = 92/180 (51%), Gaps = 6/180 (3%) Query: 67 RLRELMAE-YNRVEPKNIYPTPGGDGALRAVFYNLIQTGDKVVINNPSYSMYKVYASVRG 125 RLRE ++ Y+R P+N+ T G G V+ L++ GD V+ P+Y + G Sbjct: 65 RLREAISTMYDRQSPENVIVTHGAIGGNALVYETLVEPGDTVISVLPTYQQHYSIPESYG 124 Query: 126 LKLTRVNLIENDNWWKMNFEKFLDEAKNARLVIIDDPNNPTGSPMLKAEEDKVRALAESI 185 + + L E + + E RL+ I++PNNPTGS M + +V +A S Sbjct: 125 ADVRILKLREENGFLPDLAELRSLVNDRTRLIAINNPNNPTGSLMDEKFLTEVGNIARSC 184 Query: 186 NGFILIDEAY----YEFSGYTVAKLINKYPNLLIVRTLSKAFSLASYRVGYLIGNEEVIK 241 ++L DE Y + SGYT A + + Y + ++SK +SLA R+G++ G +++I+ Sbjct: 185 GAYVLCDEVYRGTDQQGSGYT-ASMADLYERGISTGSMSKTYSLAGLRLGWIAGPKDLIR 243 Lambda K H 0.318 0.139 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 374 Length adjustment: 30 Effective length of query: 327 Effective length of database: 344 Effective search space: 112488 Effective search space used: 112488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory