GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisD in Paraburkholderia bryophila 376MFSha3.1

Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate H281DRAFT_05652 H281DRAFT_05652 histidinol dehydrogenase

Query= BRENDA::Q8G2R2
         (430 letters)



>FitnessBrowser__Burk376:H281DRAFT_05652
          Length = 440

 Score =  389 bits (1000), Expect = e-113
 Identities = 206/432 (47%), Positives = 285/432 (65%), Gaps = 5/432 (1%)

Query: 2   VTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDL 61
           +  L  T  DF++   A L+ +    E ++R+V +I+  V+  GD+A+L+Y+ RFDR+  
Sbjct: 5   IRKLDSTARDFQKSLHAVLAFEASEDEAIERSVAQILSDVKARGDAAVLEYTNRFDRLSA 64

Query: 62  EKTG-IAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDD----RYTDALGVE 116
                + +  +E++AA +        AL+ A  R+  +H +Q  +      +YT+A G  
Sbjct: 65  NSVAALELPMSELEAALEGLEPKRRAALEAAAARVRGYHEKQKIECGSHSWQYTEADGTV 124

Query: 117 LGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAA 176
           LG + T ++  G+YVPGG A+YPSSVLMNA+PA+VAGV  IVMVVP PDG  NPLVL AA
Sbjct: 125 LGQKVTPLDRAGIYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGVKNPLVLAAA 184

Query: 177 RLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGP 236
            L GV  ++ +GGAQA+ ALAYGT+T+  V KI GPGNAYVA+AKR VFGTVGIDMIAGP
Sbjct: 185 LLGGVDRVFTIGGAQAVGALAYGTQTVPAVDKICGPGNAYVASAKRRVFGTVGIDMIAGP 244

Query: 237 SEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTE 296
           SE+L++ D   +P W+A DL +QAEHD  AQSIL+  D+AF   V +A+   L T+ R +
Sbjct: 245 SEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDDAFIGRVNDAINELLPTMPRRD 304

Query: 297 TASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTP 356
              AS    GA+I V+D  +A  +AN IA EHLEI+  +   +   IR+AG+IF+G YT 
Sbjct: 305 VIQASLEGRGALIKVRDMAEACAIANDIAPEHLEISALEPHQWGQLIRHAGAIFLGRYTS 364

Query: 357 EVIGDYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEG 416
           E +GDY  G NHVLPT+R+ARFSS L V D+ KR+S++++ +E  + LG  A E+A  EG
Sbjct: 365 ESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSVIEVSAEGAQTLGEIAAELAYGEG 424

Query: 417 LDAHAQSVAIRL 428
           L AHA+S   R+
Sbjct: 425 LQAHARSAEYRM 436


Lambda     K      H
   0.318    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 449
Number of extensions: 25
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 430
Length of database: 440
Length adjustment: 32
Effective length of query: 398
Effective length of database: 408
Effective search space:   162384
Effective search space used:   162384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate H281DRAFT_05652 H281DRAFT_05652 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))

Software error:

../bin/blast/fastacmd -i /tmp/list.30034.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.30034.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.