Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate H281DRAFT_05659 H281DRAFT_05659 imidazole glycerol phosphate synthase subunit hisF
Query= BRENDA::Q5NMD6 (255 letters) >FitnessBrowser__Burk376:H281DRAFT_05659 Length = 257 Score = 311 bits (797), Expect = 8e-90 Identities = 153/256 (59%), Positives = 199/256 (77%), Gaps = 5/256 (1%) Query: 1 MTLCTRIIPCLDVADGRVVKGVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGR 60 M L RIIPCLDV GRVVKGVNF +L DAGDPVE A+ YD GADEL FLDI+A+ + R Sbjct: 1 MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQR 60 Query: 61 GTMLDVVARTAEVCFMPLTVGGGVRQVEDARALLLAGADKVAVNSAAVARPELVAEIADR 120 +L ++ A F+PLTVGGGVR VED R LL AGADK+++NS+AVA P+LV + D+ Sbjct: 61 DLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKISMNSSAVANPQLVKDATDK 120 Query: 121 FGAQCVVAAIDARR---NGD--HWEVYTHGGRRPTGINALDHALNLTRLGAGEILLTSMD 175 +G+QC+V AIDA+R +G+ WEV+THGGR+ TG+ A++ A + LGAGEILLTSMD Sbjct: 121 YGSQCIVVAIDAKRVSADGETPRWEVFTHGGRKATGLEAVEWARKMAELGAGEILLTSMD 180 Query: 176 KDGTRDGYDLELTRLVADSVPVPVIASGGVGNLDHMVEGVTKGHASALLAASIFHFGQYS 235 +DGT+ G+DL LTR V+D+VPVPVIASGGVGNL H+ +G+T GHA A+LAASIFH+G+++ Sbjct: 181 RDGTKSGFDLALTRAVSDAVPVPVIASGGVGNLQHLADGITSGHADAVLAASIFHYGEHT 240 Query: 236 LAEAHEALAKAGLTVR 251 + EA +A+ G++VR Sbjct: 241 VGEAKRFMAEQGISVR 256 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 257 Length adjustment: 24 Effective length of query: 231 Effective length of database: 233 Effective search space: 53823 Effective search space used: 53823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate H281DRAFT_05659 H281DRAFT_05659 (imidazole glycerol phosphate synthase subunit hisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.12446.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-118 381.1 0.9 1.2e-118 381.0 0.9 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_05659 H281DRAFT_05659 imidazole glycer Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_05659 H281DRAFT_05659 imidazole glycerol phosphate synthase subunit hisF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 381.0 0.9 1.2e-118 1.2e-118 2 254 .] 3 256 .. 2 256 .. 0.98 Alignments for each domain: == domain 1 score: 381.0 bits; conditional E-value: 1.2e-118 TIGR00735 2 lakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevve 67 lakriipCLdv++grvvkGv+f +lrdaGdpve+a++yd++Gadel+fldita+s++r+ +l ++e lcl|FitnessBrowser__Burk376:H281DRAFT_05659 3 LAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIE 68 9***************************************************************** PP TIGR00735 68 rvaekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakr 133 va +vfiPltvgGG++ +edv++ll+aGadk+s+n++av++p+l+k+++d++Gsq+ivvaidakr lcl|FitnessBrowser__Burk376:H281DRAFT_05659 69 AVASQVFIPLTVGGGVRAVEDVRRLLNAGADKISMNSSAVANPQLVKDATDKYGSQCIVVAIDAKR 134 *****************************************************************9 PP TIGR00735 134 eae.neeakyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeav 198 + e +ev ++gGr+ t+l++vewa++++elGaGeilltsmd+dGtksG+dl+l+++v++av lcl|FitnessBrowser__Burk376:H281DRAFT_05659 135 VSAdGETPRWEVFTHGGRKATGLEAVEWARKMAELGAGEILLTSMDRDGTKSGFDLALTRAVSDAV 200 86515679********************************************************** PP TIGR00735 199 kiPviasgGaGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254 +PviasgG+G+ +hl++++++g+ada+Laas+fh++e t++e k+++ae+g++vr lcl|FitnessBrowser__Burk376:H281DRAFT_05659 201 PVPVIASGGVGNLQHLADGITSGHADAVLAASIFHYGEHTVGEAKRFMAEQGISVR 256 ******************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory