Align HAD family hydrolase (characterized, see rationale)
to candidate H281DRAFT_05697 H281DRAFT_05697 2-haloacid dehalogenase
Query= uniprot:A0A0L7BRC5 (209 letters) >FitnessBrowser__Burk376:H281DRAFT_05697 Length = 207 Score = 90.5 bits (223), Expect = 2e-23 Identities = 65/212 (30%), Positives = 97/212 (45%), Gaps = 19/212 (8%) Query: 6 ITDVIFDFCGVLLDWNTRACLEGKFPDDVVNR-----ICANDDPCGFFHYEDRMDAGEDL 60 I V+FDF GVL+DW+ PD+ R +C+ D + R D G+ + Sbjct: 3 IKAVVFDFGGVLIDWSPEYLYRQLIPDEAERRWFLTHVCSMD-------WVIRQDGGQPI 55 Query: 61 ADILPDVRREQGDELAAIFEYYIAHYDDALPRTLPGMVELLEDLKAHGYGVWGLTNWSHE 120 + ++ D A I +Y + + + L V ++E L+A ++GLTNWS E Sbjct: 56 VEATEELVARFPDHEALIRAFY-ERWHEMVAGVLEDGVAIMEKLEAAEVPLFGLTNWSAE 114 Query: 121 TFHLAFEKFPRLEELLQGTVVSGVEKMHKPNADIYELALNHF-----GLTAGNCVFFDDT 175 TF A+E +P L + VVSG + KP+ I+ G+ G VF DD Sbjct: 115 TFPYAWEHYPVLRRF-RDIVVSGRVGLVKPDPAIFAAMRERIDAQLPGVEPGELVFIDDN 173 Query: 176 AKNIVGANEVGIHGLLFENALQARESLAQLGV 207 KN A +G HG+ NA Q L +LG+ Sbjct: 174 PKNAAAATALGWHGVHHTNAAQTEAKLRELGL 205 Lambda K H 0.323 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 209 Length of database: 207 Length adjustment: 21 Effective length of query: 188 Effective length of database: 186 Effective search space: 34968 Effective search space used: 34968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory