Align L-threonine dehydratase biosynthetic IlvA; EC 4.3.1.19; Threonine deaminase (uncharacterized)
to candidate H281DRAFT_01167 H281DRAFT_01167 threonine ammonia-lyase, biosynthetic, long form
Query= curated2:P53607 (507 letters) >FitnessBrowser__Burk376:H281DRAFT_01167 Length = 281 Score = 481 bits (1237), Expect = e-140 Identities = 239/280 (85%), Positives = 257/280 (91%) Query: 228 EVGLFADGTAVKLVGEETFRLCKEYLDGVVTVDTDALCAAIKDVFQDTRSVLEPSGALAV 287 EVGLF+DGTAVKLVGEETFRLC EYLD V+ V+TDALCAAIKDVFQDTRSVLEP+G+LAV Sbjct: 2 EVGLFSDGTAVKLVGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEPAGSLAV 61 Query: 288 AGAKLYAEREGIENQTLVAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFK 347 AGAK YAEREG+ENQTL+A+TSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSF+ Sbjct: 62 AGAKQYAEREGVENQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFR 121 Query: 348 RFCSLVGDRNVTEFNYRIADAQSAHIFVGVQIRRRGESADIAANFESHGFKTADLTHDEL 407 RFC LVG R+VTEFNYRIA A+SAHIFVGVQIR R ESA IA FE+H F T DLT DEL Sbjct: 122 RFCELVGTRSVTEFNYRIAQAESAHIFVGVQIRNRSESAQIAGAFEAHNFATVDLTFDEL 181 Query: 408 SKEHIRYMVGGRSPLALDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSS 467 SK+HIRYMVGGRSPLA DERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSS Sbjct: 182 SKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSS 241 Query: 468 ILVGLQVPQADHAEFERFLAALGYPYVEESANPAYRLFLS 507 ILVG+QVPQ D+AEFERFLA LGYP+ EE+ N YRLFL+ Sbjct: 242 ILVGIQVPQTDNAEFERFLATLGYPHWEETHNSVYRLFLA 281 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 507 Length of database: 281 Length adjustment: 30 Effective length of query: 477 Effective length of database: 251 Effective search space: 119727 Effective search space used: 119727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate H281DRAFT_01167 H281DRAFT_01167 (threonine ammonia-lyase, biosynthetic, long form)
to HMM TIGR01124 (ilvA: threonine ammonia-lyase, biosynthetic (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01124.hmm # target sequence database: /tmp/gapView.18984.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01124 [M=499] Accession: TIGR01124 Description: ilvA_2Cterm: threonine ammonia-lyase, biosynthetic Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-138 447.0 0.2 4.6e-138 446.8 0.2 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_01167 H281DRAFT_01167 threonine ammoni Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_01167 H281DRAFT_01167 threonine ammonia-lyase, biosynthetic, long form # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 446.8 0.2 4.6e-138 4.6e-138 220 499 .] 1 280 [. 1 280 [. 1.00 Alignments for each domain: == domain 1 score: 446.8 bits; conditional E-value: 4.6e-138 TIGR01124 220 dqvGlfadGvavkevGdetfrlckeylddivlvdtdevcaaikdvfedtravlepaGalalaGlkk 285 ++vGlf+dG+avk vG+etfrlc eyldd++lv+td++caaikdvf+dtr+vlepaG+la+aG k+ lcl|FitnessBrowser__Burk376:H281DRAFT_01167 1 NEVGLFSDGTAVKLVGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEPAGSLAVAGAKQ 66 58**************************************************************** PP TIGR01124 286 yvakkgiedktlvailsGanlnfdrlryvseraelGeqreallavtipeekGsllkfvevlGerai 351 y++++g+e++tl+ai+sGan+nfdr+r+v+erae+Ge rea++avtipee+Gs+++f+e++G r++ lcl|FitnessBrowser__Burk376:H281DRAFT_01167 67 YAEREGVENQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRRFCELVGTRSV 132 ****************************************************************** PP TIGR01124 352 tefnyrladdekahifvGvqlaeeeerkellarleeagykvvdltddelaklhvrylvGGraakve 417 tefnyr+a++e+ahifvGvq+++++e ++++ +e +++++vdlt del+k h+ry+vGGr+ ++ lcl|FitnessBrowser__Burk376:H281DRAFT_01167 133 TEFNYRIAQAESAHIFVGVQIRNRSESAQIAGAFEAHNFATVDLTFDELSKQHIRYMVGGRSPLAH 198 ****************************************************************** PP TIGR01124 418 nerlysfefperpGallkfletlqaewnislfhyrnhGadyGrvlvglevpdeeaeefeqflaelg 483 +erl++fefperpGal+kfl+++ ++wnislfhyrn Gady +lvg++vp+++++efe fla+lg lcl|FitnessBrowser__Burk376:H281DRAFT_01167 199 DERLFRFEFPERPGALMKFLSSMAPDWNISLFHYRNQGADYSSILVGIQVPQTDNAEFERFLATLG 264 ****************************************************************** PP TIGR01124 484 yryedetenpayrlfl 499 y ++et+n++yrlfl lcl|FitnessBrowser__Burk376:H281DRAFT_01167 265 YPHWEETHNSVYRLFL 280 ***************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (499 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.74 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory