Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 (characterized)
to candidate H281DRAFT_01480 H281DRAFT_01480 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::Q9X1K9 (294 letters) >FitnessBrowser__Burk376:H281DRAFT_01480 Length = 299 Score = 168 bits (426), Expect = 1e-46 Identities = 97/297 (32%), Positives = 160/297 (53%), Gaps = 19/297 (6%) Query: 1 MFRGVGTAIVTPFKNGELDLESYERLVRYQLENGVNALIVLGTTGESPTVNEDEREKLVS 60 +F G+ ++TPF + +D + LVR + G+ ++ LGTTGE ++ E++ +++ Sbjct: 3 IFSGIWVPLITPFADAAVDHAAVRALVRRYADAGIAGIVALGTTGEPAALSAAEQDAVLA 62 Query: 61 RTLEIV-----------DGK--IPVIVGAGTNSTEKTLKLVKQAEKLGANGVLVVTPYYN 107 L+ D K +PV+VG N+T+ + + Q L GVL+ PYY Sbjct: 63 TILDAAQAGGARADASTDSKPALPVVVGVSGNNTQSMRERIAQLNSLPVAGVLMAAPYYI 122 Query: 108 KPTQEGLYQHYKYISERTDLGIVVYNVPGRTGVNVLPETAARIAADLKNVVGIKEANPDI 167 +P+Q G+ H+ +++ ++ +V+Y++P RTGV + +T +AA + I+ Sbjct: 123 RPSQAGIVGHFMALADASEKPVVLYDIPYRTGVRLELDTLMTLAAHPR----IQAVKDCA 178 Query: 168 DQIDRTVSLTKQARSDFMVWSGNDDRTFYLLCAGGDGVISVVSNVAPKQMVELCAEYFSG 227 +D T++L + R V +G D + F +C GG G I+ ++V P++ V L +G Sbjct: 179 GSLDTTLALIRDGR--LQVLAGEDMQMFNTMCLGGSGAIAASAHVQPERFVALYRALAAG 236 Query: 228 NLEKSREVHRKLRPLMKALFVETNPIPVKAALNLMGFIENELRLPLVPASEKTVELL 284 LE++R + L PL+ LF E NP PVKA L G I +ELRLP+ ASEK VE L Sbjct: 237 ALEEARRIFHALAPLIDTLFAEPNPAPVKAMLASQGLIRDELRLPMTRASEKLVERL 293 Lambda K H 0.316 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 299 Length adjustment: 26 Effective length of query: 268 Effective length of database: 273 Effective search space: 73164 Effective search space used: 73164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_01480 H281DRAFT_01480 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.7597.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-77 243.8 0.0 9.4e-77 243.6 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_01480 H281DRAFT_01480 4-hydroxy-tetrah Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_01480 H281DRAFT_01480 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 243.6 0.0 9.4e-77 9.4e-77 4 281 .. 9 295 .. 6 299 .] 0.97 Alignments for each domain: == domain 1 score: 243.6 bits; conditional E-value: 9.4e-77 TIGR00674 4 tAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvkn... 66 + liTPf + vd aa+ l+++ ++g+ +iv++GtTGE a+Ls E+ +v+ + ++ ++ lcl|FitnessBrowser__Burk376:H281DRAFT_01480 9 VPLITPFADAA-VDHAAVRALVRRYADAGIAGIVALGTTGEPAALSAAEQDAVLATILDAAQAgga 73 679****9988.***********************************************999899* PP TIGR00674 67 ..........rvpviaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaee 122 +pv++G+++n+t+ e +++++ l+v+gvl+ +PyY +P+q G++ hf a+a++ lcl|FitnessBrowser__Burk376:H281DRAFT_01480 74 radastdskpALPVVVGVSGNNTQSMRERIAQLNSLPVAGVLMAAPYYIRPSQAGIVGHFMALADA 139 ********999******************************************************* PP TIGR00674 123 velPiilYnvPsRtgvslepetvkrLaeeveivaiKeasgdlervseikaeakedfkvlsGdDalt 188 +e+P++lY++P Rtgv le +t++ La++++i a+K+++g+l+ +++ + ++vl+G+D + lcl|FitnessBrowser__Burk376:H281DRAFT_01480 140 SEKPVVLYDIPYRTGVRLELDTLMTLAAHPRIQAVKDCAGSLDTTLALIR--DGRLQVLAGEDMQM 203 *******************************************9999998..557*********** PP TIGR00674 189 leilalGakGviSVasnvapkelkemvkaalegdteeareihqkllklfkalfietNPipvKtala 254 + ++lG++G i ++v p+++ +++a ++g+ eear i + l +l+++lf e+NP pvK++la lcl|FitnessBrowser__Burk376:H281DRAFT_01480 204 FNTMCLGGSGAIAASAHVQPERFVALYRALAAGALEEARRIFHALAPLIDTLFAEPNPAPVKAMLA 269 ****************************************************************** PP TIGR00674 255 llgliekdelRlPLtelseekkeklke 281 +gli elRlP+t +se+ e+l++ lcl|FitnessBrowser__Burk376:H281DRAFT_01480 270 SQGLIRD-ELRLPMTRASEKLVERLAA 295 ******9.**********998887765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.92 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory