Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate H281DRAFT_00597 H281DRAFT_00597 succinyldiaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >lcl|FitnessBrowser__Burk376:H281DRAFT_00597 H281DRAFT_00597 succinyldiaminopimelate desuccinylase Length = 379 Score = 474 bits (1221), Expect = e-138 Identities = 232/376 (61%), Positives = 282/376 (75%), Gaps = 4/376 (1%) Query: 6 SLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRR----GTKAP 61 +L L ++LI+R SVTPDD+ CQ+LL ERL +GF E + N+W + G Sbjct: 4 TLALTEQLIARASVTPDDQHCQRLLIERLSALGFEHETIESNGVTNLWAVKRGVDGRAGK 63 Query: 62 VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHP 121 ++ FAGHTDVVPTGP+E+W S PFEP RDG+LYGRGAADMKTSIA FV A E FVA HP Sbjct: 64 LLAFAGHTDVVPTGPLEQWQSAPFEPTHRDGKLYGRGAADMKTSIAGFVVASEEFVAAHP 123 Query: 122 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181 H+GSIA LITSDEEG A DGT KVV+ L+AR E +DYCIVGEPT+ + GD +KNGRRG Sbjct: 124 RHRGSIAFLITSDEEGPATDGTVKVVEALQARGERMDYCIVGEPTSSTQFGDTVKNGRRG 183 Query: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241 S+SG L VKG QGHIAYPHLA NPVH APAL EL E WD+GNEYFPPT++Q+SNI+ G Sbjct: 184 SMSGKLVVKGVQGHIAYPHLARNPVHLLAPALAELVAERWDDGNEYFPPTTWQVSNIHSG 243 Query: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAGK 301 TGATNVIPG +V FNFRFST ST GL+QRVHAILD+HG++YDLQW+ SG PFLT G Sbjct: 244 TGATNVIPGHADVMFNFRFSTASTVEGLQQRVHAILDRHGLEYDLQWTVSGLPFLTPHGD 303 Query: 302 LTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDI 361 L++ AI + G+ ELSTTGGTSDGRFI I Q+++E GP NA+IH+I+E++ + I Sbjct: 304 LSNALAKAIKDETGVSTELSTTGGTSDGRFIARICQQVVEFGPLNASIHKIDEHIDVAHI 363 Query: 362 PKLSAVYEGILARLLA 377 L VY +L +L+A Sbjct: 364 EPLKNVYRRVLEQLIA 379 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 379 Length adjustment: 30 Effective length of query: 351 Effective length of database: 349 Effective search space: 122499 Effective search space used: 122499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate H281DRAFT_00597 H281DRAFT_00597 (succinyldiaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.24331.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-165 535.0 0.0 5.4e-165 534.8 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_00597 H281DRAFT_00597 succinyldiaminop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_00597 H281DRAFT_00597 succinyldiaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 534.8 0.0 5.4e-165 5.4e-165 3 370 .] 6 377 .. 4 377 .. 0.98 Alignments for each domain: == domain 1 score: 534.8 bits; conditional E-value: 5.4e-165 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt....eepvlvfaGht 64 +l+++Li r svtP+d+ +q l++erL++lgfe e++e ++++nlwa ++ + l+faGht lcl|FitnessBrowser__Burk376:H281DRAFT_00597 6 ALTEQLIARASVTPDDQHCQRLLIERLSALGFEHETIESNGVTNLWAVKRGvdgrAGKLLAFAGHT 71 6899******************************************9775557767889******* PP TIGR01246 65 DvvPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDe 130 DvvP+G+le+W+s pfep++rdGklygrGaaDmk+s+a fvva+e+fv++++ h+Gs+++litsDe lcl|FitnessBrowser__Burk376:H281DRAFT_00597 72 DVVPTGPLEQWQSAPFEPTHRDGKLYGRGAADMKTSIAGFVVASEEFVAAHPRHRGSIAFLITSDE 137 ****************************************************************** PP TIGR01246 131 egeaidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhk 196 eg a dGt+kvve l++r e +dy++vgeP+s+ + GD++k+GrrGs++gkl +kG+qGh+aYPh+ lcl|FitnessBrowser__Burk376:H281DRAFT_00597 138 EGPATDGTVKVVEALQARGERMDYCIVGEPTSSTQFGDTVKNGRRGSMSGKLVVKGVQGHIAYPHL 203 ****************************************************************** PP TIGR01246 197 aenPvhkavpvlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevsee 262 a+nPvh ++p+l+el+a+++D+Gne+fpp+ q++ni++gtga+nviPg+++v+fn+rfs+ +++e lcl|FitnessBrowser__Burk376:H281DRAFT_00597 204 ARNPVHLLAPALAELVAERWDDGNEYFPPTTWQVSNIHSGTGATNVIPGHADVMFNFRFSTASTVE 269 ****************************************************************** PP TIGR01246 263 elkskvekildkhkldYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfia 328 l+++v++ild+h+l+Y+l+w++sg pflt +g+l +++a+ai+ ++ ++elst+GGtsD+rfia lcl|FitnessBrowser__Burk376:H281DRAFT_00597 270 GLQQRVHAILDRHGLEYDLQWTVSGLPFLTPHGDLSNALAKAIKDETGVSTELSTTGGTSDGRFIA 335 ****************************************************************** PP TIGR01246 329 klgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 ++ ++vve+G++n++ihk++e++ ++ +e l++vy+++le+l lcl|FitnessBrowser__Burk376:H281DRAFT_00597 336 RICQQVVEFGPLNASIHKIDEHIDVAHIEPLKNVYRRVLEQL 377 ***************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.46 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory