Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate H281DRAFT_02421 H281DRAFT_02421 sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family
Query= curated2:Q8TY70 (245 letters) >FitnessBrowser__Burk376:H281DRAFT_02421 Length = 214 Score = 67.4 bits (163), Expect = 2e-16 Identities = 41/130 (31%), Positives = 69/130 (53%), Gaps = 9/130 (6%) Query: 103 IEPGAIIREKVKLGKGVVVMMGAVINIGAKIGDGTMVDMNAVVGSRAEVGKNVHIGAGAV 162 I+ +++ V LG+G+VV I+ A++G V+ ++VG +VG+N + + Sbjct: 90 IDVSSLVAGTVSLGEGLVVTPLCSISSDAQLGRNVCVNTMSIVGHDVQVGENTVVSSMVN 149 Query: 163 IAGVLEPPSAKPVVIEDDVVIGANAVILEGVRVGKGAVVAAGAVVTEDVPPSKVVAGVPA 222 I G VI + +G A+I EGVR+G ++V G+VV D+P + G PA Sbjct: 150 IGGAC--------VIGANSYLGMGALIKEGVRIGSNSIVGMGSVVYSDIPDDVIALGNPA 201 Query: 223 RVVK-DVDKK 231 RV + + D+K Sbjct: 202 RVARPNTDRK 211 Score = 31.6 bits (70), Expect = 1e-05 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Query: 100 DVRIEPGAIIREKVKLGKGVVVMMGAVINIGAK--IGDGTMVDMNAVVGSRAEVGKNVHI 157 +V + +I+ V++G+ VV +++NIG IG + + M A++ +G N + Sbjct: 123 NVCVNTMSIVGHDVQVGENTVV--SSMVNIGGACVIGANSYLGMGALIKEGVRIGSNSIV 180 Query: 158 GAGAVI 163 G G+V+ Sbjct: 181 GMGSVV 186 Score = 31.2 bits (69), Expect = 2e-05 Identities = 13/56 (23%), Positives = 29/56 (51%) Query: 100 DVRIEPGAIIREKVKLGKGVVVMMGAVINIGAKIGDGTMVDMNAVVGSRAEVGKNV 155 DV++ ++ V +G V+ + + +GA I +G + N++VG + V ++ Sbjct: 135 DVQVGENTVVSSMVNIGGACVIGANSYLGMGALIKEGVRIGSNSIVGMGSVVYSDI 190 Lambda K H 0.315 0.136 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 14 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 5 Number of HSP's successfully gapped: 3 Length of query: 245 Length of database: 214 Length adjustment: 23 Effective length of query: 222 Effective length of database: 191 Effective search space: 42402 Effective search space used: 42402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory