Align δ1-pyrroline-5-carboxylate synthetase (EC 1.2.1.41; EC 2.7.2.11) (characterized)
to candidate H281DRAFT_06264 H281DRAFT_06264 glutamate 5-kinase
Query= metacyc::AT2G39800-MONOMER (717 letters) >FitnessBrowser__Burk376:H281DRAFT_06264 Length = 372 Score = 149 bits (375), Expect = 3e-40 Identities = 99/284 (34%), Positives = 152/284 (53%), Gaps = 20/284 (7%) Query: 8 RAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSSGAVGLGR 67 R+ D +R+VVKVG+++VT G L +G Q+A L + EV+LVSSGA+ G Sbjct: 2 RSVIADSRRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAALRAQSKEVVLVSSGAIAEGM 61 Query: 68 QRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQLLVNDSS 127 QRL + ++P+ + +A A VGQ L YE+ F + + AQ+L+ + Sbjct: 62 QRLGWS----------KRPREIDELQAAAAVGQMGLAQVYESRFAEHSIQTAQILLTHAD 111 Query: 128 FRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPYQDSSGIFWDNDSLAALLALEL 187 D++ T+ ++L L V+PI NEND + T F DND+L AL+A + Sbjct: 112 LADRERYLNARSTLLTLLRLGVVPIINENDTVVTDEIK-------FGDNDTLGALVANLI 164 Query: 188 KADLLILLSDVEGLYTGPP-SDPNSKLI-HTFVKEKHQDEITFGDKSRLGRGGMTAKVKA 245 + D LI+L+D +GL+T P DPN+ L+ + + G S LGRGGM K+ A Sbjct: 165 EGDALIILTDQQGLFTADPRKDPNATLVQQADAGAPDLEAMAGGAGSSLGRGGMLTKILA 224 Query: 246 AVNAAYAGIPVIITSGYSAENIDKVLRGLRVGT-LFHQDARLWA 288 A AA++G +I SG A+ + ++ G +GT L + AR+ A Sbjct: 225 AKRAAHSGANTVIASGREADVLSRLASGEAIGTQLIARTARMAA 268 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 372 Length adjustment: 35 Effective length of query: 682 Effective length of database: 337 Effective search space: 229834 Effective search space used: 229834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory