GapMind for Amino acid biosynthesis

 

Alignments for a candidate for thrB in Paraburkholderia bryophila 376MFSha3.1

Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate H281DRAFT_06029 H281DRAFT_06029 homoserine kinase

Query= SwissProt::P29364
         (316 letters)



>FitnessBrowser__Burk376:H281DRAFT_06029
          Length = 331

 Score =  220 bits (560), Expect = 4e-62
 Identities = 132/318 (41%), Positives = 169/318 (53%), Gaps = 14/318 (4%)

Query: 1   MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60
           M+VFT +  S L  ++  YDLG + +FRGI  G ENSNFF++   GE+VLT+ E+     
Sbjct: 1   MAVFTAVTESQLADWMRHYDLGEVVEFRGITSGIENSNFFLTTTRGEYVLTIFEKLTAGQ 60

Query: 61  LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120
           LPF++ L+  L E  +PVP  +   DG     L GKPA +  +L G  E  P   HC EV
Sbjct: 61  LPFYLNLMRHLAEHRVPVPDPMPREDGSLFGILHGKPAAIVTKLEGAPELAPGVEHCIEV 120

Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALA--EIAALDA 178
           G +L  +H A R     +P+ R LPW  E    + P L  + R LL+  LA  E     A
Sbjct: 121 GQMLARMHLAGRDYTGYQPNLRSLPWWKETVPTILPFLEGEQRDLLSSELAYQEAFFASA 180

Query: 179 ERPALPRANLHADLFRDNVLF--------DGPHLAGLIDFYNA-CSGWMLYDLAITLNDW 229
           +  ALP    HADLFRDN +F            L G  DFY A C  W L+D+A+T+NDW
Sbjct: 181 DYAALPEGPCHADLFRDNAMFAHAAPETGHEVRLGGFFDFYFAGCDKW-LFDVAVTVNDW 239

Query: 230 CSN-TDGSLDPARARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQ 288
           C +   G LD AR  A+L AY   RPFT  E  HW  MLR    RFW+SRL         
Sbjct: 240 CVDLATGKLDEARTEAMLRAYQTVRPFTVEENRHWGDMLRTGAYRFWVSRLYDFHLPRAA 299

Query: 289 DVL-IHDPAEFEIRLAQR 305
           ++L  HDP  FE  L +R
Sbjct: 300 ELLKPHDPGHFERILRER 317


Lambda     K      H
   0.324    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 301
Number of extensions: 10
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 316
Length of database: 331
Length adjustment: 28
Effective length of query: 288
Effective length of database: 303
Effective search space:    87264
Effective search space used:    87264
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

Align candidate H281DRAFT_06029 H281DRAFT_06029 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))

Software error:

../bin/blast/fastacmd -i /tmp/list.3360.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3360.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.