Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate H281DRAFT_05564 H281DRAFT_05564 Aspartate/methionine/tyrosine aminotransferase
Query= BRENDA::Q56232 (385 letters) >FitnessBrowser__Burk376:H281DRAFT_05564 Length = 392 Score = 213 bits (541), Expect = 1e-59 Identities = 143/396 (36%), Positives = 203/396 (51%), Gaps = 24/396 (6%) Query: 4 LSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK 63 +S R +++ P + +A L QG ++ L+ GEPDF P V AAR A+ Sbjct: 3 ISERAKSISPFFAMEFGKRAAALEAQGHHIIKLSIGEPDFGAPPAVSLAAREAMDGRSLA 62 Query: 64 YAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSP 123 Y GIP LREA+A +R + + V +VT G AL + A++DPGDEVIV P Sbjct: 63 YTSALGIPALREAIAGFYREVHDVEVHSSRIVVTAGASAALLLVTAALVDPGDEVIVGDP 122 Query: 124 YWVSYPEMVRFAGGVVVEVETLPEEG---FVPDPERVRRAITPRTKALVVNSPNNPTGAV 180 SYP +F +V+ +P + F D VR T +T+ L++ +P+NPTG Sbjct: 123 ---SYPCNRQFLASFGAQVKLVPTDANTRFQLDAAAVRANWTEKTRGLMIATPSNPTGTS 179 Query: 181 YPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLT-------VNGAA 233 P LEA+ A +H+ + + DEIY +L G+H + GR AP+ L+ +N + Sbjct: 180 IPPHELEAICSWAHQHNAWRIVDEIYLNL---GDHDAHGR-APQTVLSFDPDAIVINSFS 235 Query: 234 KAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAR 293 K F MTGWR+G+ P ++ M ++ P TI+Q A L T + S A E R Sbjct: 236 KYFGMTGWRLGWCVVPDALVPTMERLAQNYYICPSTISQHAALACFTRE--SLALCEARR 293 Query: 294 EAYRRRRDLLLEGLTALGLKA-VRPSGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPG 351 + + RR L+L GL +GL V P GAFYV D ER L EA VA+ PG Sbjct: 294 QQFAERRALVLAGLERIGLPVPVPPDGAFYVYFDVGHTGLTSWEFCERALEEAHVALTPG 353 Query: 352 TDFAAFG---HVRLSYATSEENLRKALERFARVLGR 384 DF + G VRLSYA S +L +A+ER ++ R Sbjct: 354 KDFGSCGAETFVRLSYAASTSDLAEAIERLGSLMNR 389 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 392 Length adjustment: 30 Effective length of query: 355 Effective length of database: 362 Effective search space: 128510 Effective search space used: 128510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory