Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate H281DRAFT_04552 H281DRAFT_04552 acetolactate synthase, small subunit
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__Burk376:H281DRAFT_04552 Length = 163 Score = 191 bits (484), Expect = 6e-54 Identities = 92/163 (56%), Positives = 131/163 (80%), Gaps = 1/163 (0%) Query: 1 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60 MR I+SVLLENE GALSRV+GLFS RGYNIE+LTVAPT+D +LSRMTI ++G + V+EQI Sbjct: 1 MRHIISVLLENEPGALSRVVGLFSARGYNIETLTVAPTEDRSLSRMTIVSIGSDDVIEQI 60 Query: 61 EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120 K L++L++V++V +L +GAH+ERE+ML+K++A G R+E+KR ++IFRG+IIDVT Y Sbjct: 61 TKHLNRLIEVVKVVDLTEGAHIERELMLIKVRAVGKEREEMKRMSDIFRGRIIDVTEKTY 120 Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR 163 T++L G + KLDAF+ + D I+E R+G G+ RG++I++ Sbjct: 121 TIELTGAADKLDAFIEGL-DATAILETVRTGSSGIGRGERILK 162 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 163 Length adjustment: 18 Effective length of query: 145 Effective length of database: 145 Effective search space: 21025 Effective search space used: 21025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate H281DRAFT_04552 H281DRAFT_04552 (acetolactate synthase, small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00119.hmm # target sequence database: /tmp/gapView.8181.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00119 [M=158] Accession: TIGR00119 Description: acolac_sm: acetolactate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-66 209.1 2.7 2e-66 208.9 2.7 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_04552 H281DRAFT_04552 acetolactate syn Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_04552 H281DRAFT_04552 acetolactate synthase, small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 208.9 2.7 2e-66 2e-66 1 157 [. 1 157 [. 1 158 [. 0.99 Alignments for each domain: == domain 1 score: 208.9 bits; conditional E-value: 2e-66 TIGR00119 1 kkhvlsvlvenepGvLsrvsGlfarrgfniesltvgeteekdlsrmtivvegddkvveqiekqlek 66 ++h++svl+enepG+Lsrv+Glf++rg+nie+ltv+ te++ lsrmtiv g d+v+eqi+k l++ lcl|FitnessBrowser__Burk376:H281DRAFT_04552 1 MRHIISVLLENEPGALSRVVGLFSARGYNIETLTVAPTEDRSLSRMTIVSIGSDDVIEQITKHLNR 66 69**************************************************************** PP TIGR00119 67 lvdvlkvldlteseivkrelvlvkvsalgeerneikelteifrgrvvDvsedslivelsgkedkis 132 l++v+kv+dlte ++++rel+l+kv+a+g+er+e+k++ +ifrgr++Dv+e+++++el+g dk++ lcl|FitnessBrowser__Burk376:H281DRAFT_04552 67 LIEVVKVVDLTEGAHIERELMLIKVRAVGKEREEMKRMSDIFRGRIIDVTEKTYTIELTGAADKLD 132 ****************************************************************** PP TIGR00119 133 aflkllkefgikevarsGlvalsrg 157 af++ l +i+e +r+G ++ rg lcl|FitnessBrowser__Burk376:H281DRAFT_04552 133 AFIEGLDATAILETVRTGSSGIGRG 157 ********************99998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (158 nodes) Target sequences: 1 (163 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.14 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory