Align cysteine synthase (EC 2.5.1.47); cystathionine beta-synthase (EC 4.2.1.22) (characterized)
to candidate CCNA_03740 CCNA_03740 cysteine synthase
Query= BRENDA::F9UT54 (303 letters) >FitnessBrowser__Caulo:CCNA_03740 Length = 328 Score = 216 bits (549), Expect = 7e-61 Identities = 122/299 (40%), Positives = 177/299 (59%), Gaps = 5/299 (1%) Query: 8 ELIGHTPLMALP---IEVPNHSHIYAKLEMFNPGGSIKDRLGAYLIEDGLQRGRVNAKTT 64 + IG TPL+ LP E+ + + AKLE FNP S+KDR+G +IE +G + T Sbjct: 27 DTIGDTPLVRLPRLSAELNPKAEVLAKLEFFNPIASVKDRIGVSMIESLEAQGVLKPGAT 86 Query: 65 IIEPTAGNTGIGLALATQAHHLRTILVVPEKFSMEKQVLMQALGAEIVHTPSEEGIKGAI 124 IIEPT+GNTGI LA A + LV+PE S+E++ ++ LGA++ TP+E+G++GA+ Sbjct: 87 IIEPTSGNTGIALAFVAAAKGYKLTLVMPESMSIERRKMLLLLGAKLELTPAEKGMRGAV 146 Query: 125 RKAEALAATISNSYVPMQFKNPANPAAYYHTLAPEILADMPAPITAFVAGAGSGGTFAGV 184 +A+ L + +P QF+N ANP + + A EI D + A V+G G+GGT GV Sbjct: 147 TRAQELIEATPGAVMPQQFENSANPLIHRVSTAEEIWNDTAGAVDAVVSGVGTGGTITGV 206 Query: 185 AAYLQAQDSATKAVVVEPEGS-ILNGGPAHAHRTEGIGVEFIPPFFDQVRIDQTLTIADN 243 L+A+ + K V VEPE S +L+GG H+ +GIG F+P D+ ID + ++++ Sbjct: 207 GQALKARKPSLKMVAVEPEASPVLSGGAPGPHKIQGIGAGFVPGVLDRGVIDDIVQVSND 266 Query: 244 DAFAQVRHLARDHGLLIGSSSGAALAASLQLA-TNLPANSHIVTIFPDSSERYLSQKIY 301 DAFA R A GL +G SSGAAL A+ LA + IV I P +ERYLS ++ Sbjct: 267 DAFAMARRAAATEGLPVGISSGAALTAAFDLALRDAYKGKTIVVIIPSFAERYLSTALF 325 Lambda K H 0.317 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 328 Length adjustment: 27 Effective length of query: 276 Effective length of database: 301 Effective search space: 83076 Effective search space used: 83076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory