Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate CCNA_01493 CCNA_01493 cysteine synthase
Query= BRENDA::P9WP53 (323 letters) >FitnessBrowser__Caulo:CCNA_01493 Length = 332 Score = 145 bits (366), Expect = 1e-39 Identities = 112/324 (34%), Positives = 157/324 (48%), Gaps = 33/324 (10%) Query: 1 MTRYDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIE 60 M+ S+L A+GNTPL+ L R S + + K E NP S+KDR A+ +I Sbjct: 1 MSALPSVLDAIGNTPLIRLARAS-------EATGCEILGKAEFMNPGQSVKDRAALAIIR 53 Query: 61 QAEADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQI 120 AEA GLLRPG I+E T+GNTGI LAM A GY+ V+P S E++ + L GA++ Sbjct: 54 DAEAKGLLRPGGRIVEGTAGNTGIGLAMVASALGYKTTIVIPRTQSQEKKDAIRLLGAEL 113 Query: 121 I------FSAAEGGSNTAVATAKELAATNPSWVM-LYQYGNPANTDSHYCGTGPELLADL 173 + +S + + A+ELA T P V+ Q+ N AN D+HY TGPE+ Sbjct: 114 VEVDAVPYSNPDNYVRYSGRLAEELARTEPHGVIWANQFDNTANRDAHYHTTGPEIFDQT 173 Query: 174 P-EITHFVAGLGTTGTLMGTGRFLREHVANVKIVAAEPRYGEGVYALRNMDE-----GFV 227 ++ F+ +G+ GTL G LRE V+I A+P YG +YA E + Sbjct: 174 SGKVDGFICAVGSGGTLAGVAAALRERKPGVRIGLADP-YGAALYAWYKDGELKSEGSSI 232 Query: 228 PELYDPEILTARYSVGAVDAVRRTR---------ELVHTEGIFAGISTGAVLHAALGVGA 278 E +TA A+D R +LV EG+ G S G + A+ + Sbjct: 233 SEGIGQGRITANLEGLAIDDPFRVSDQEMLEVLYDLVQHEGLCLGGSAGINVAGAIKL-- 290 Query: 279 GALAAGERADIALVVADAGWKYLS 302 A A G I V+ D G +Y S Sbjct: 291 -ATAMGPGHTIVTVLCDHGSRYQS 313 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 332 Length adjustment: 28 Effective length of query: 295 Effective length of database: 304 Effective search space: 89680 Effective search space used: 89680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory