Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate CCNA_02734 CCNA_02734 serine acetyltransferase
Query= BRENDA::Q0ZB96 (273 letters) >FitnessBrowser__Caulo:CCNA_02734 Length = 290 Score = 276 bits (707), Expect = 3e-79 Identities = 136/249 (54%), Positives = 175/249 (70%) Query: 9 VWNNIKAEARALADCEPMLASFYHATLLKHENLGSALSYMLANKLASPIMPAIAIREVVE 68 VW ++ +A A EP LAS +A +L H+NL AL++ LA KL M A+ RE Sbjct: 27 VWVALRNQAEHAAKAEPALASLLNAVILSHDNLADALTFQLARKLGDQEMRAMTAREFAA 86 Query: 69 EAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWTQGRRAL 128 +A+ D ++ +A D++AV RDPA Y P L+ KGF ALQ +R+ HWLW QGR L Sbjct: 87 DAFEDDLSIVEAAEADLKAVFERDPACKGYVQPFLFFKGFLALQTHRVSHWLWNQGRETL 146 Query: 129 AIFLQNQVSVSFQVDIHPAAKIGRGIMLDHATGIVVGETAVIEDDVSILQSVTLGGTGKT 188 A +LQ++ S FQVDI+PAAKIG+G+ +DH TGIV+GETAV+ DDVS+L VTLGGTG Sbjct: 147 AFYLQSRSSEVFQVDINPAAKIGKGVFIDHGTGIVIGETAVVGDDVSMLHGVTLGGTGAE 206 Query: 189 SGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKPE 248 GDRHPKI +GV++GAGAK+LGNI VG AK+ +GSVVL+PVP H TAAGVPAR+V P Sbjct: 207 RGDRHPKIGKGVLLGAGAKVLGNITVGDYAKVASGSVVLRPVPAHCTAAGVPARLVNCPT 266 Query: 249 SDKPAMDMD 257 ++PA MD Sbjct: 267 CEEPAKTMD 275 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 290 Length adjustment: 26 Effective length of query: 247 Effective length of database: 264 Effective search space: 65208 Effective search space used: 65208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate CCNA_02734 CCNA_02734 (serine acetyltransferase)
to HMM TIGR01172 (cysE: serine O-acetyltransferase (EC 2.3.1.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01172.hmm # target sequence database: /tmp/gapView.8948.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01172 [M=162] Accession: TIGR01172 Description: cysE: serine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-74 233.1 1.4 1.3e-73 232.5 0.3 1.7 2 lcl|FitnessBrowser__Caulo:CCNA_02734 CCNA_02734 serine acetyltransfer Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_02734 CCNA_02734 serine acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.079 0.079 5 48 .. 35 79 .. 31 89 .. 0.76 2 ! 232.5 0.3 1.3e-73 1.3e-73 2 162 .] 100 260 .. 99 260 .. 0.99 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.079 TIGR01172 5 lkavlerDPaaesale.vlllykglhallayrlahalykrklkll 48 +++ + +Pa s l+ v+l + l l+++la +l ++++++ lcl|FitnessBrowser__Caulo:CCNA_02734 35 AEHAAKAEPALASLLNaVILSHDNLADALTFQLARKLGDQEMRAM 79 566778899998887537788889998999999999888777655 PP == domain 2 score: 232.5 bits; conditional E-value: 1.3e-73 TIGR01172 2 kedlkavlerDPaaesalevlllykglhallayrlahalykrklkllarllselvrvltgvdihPaakigrgv 74 ++dlkav+erDPa++ +++++l++kg+ al+++r++h+l+++++++la +l+++++ +++vdi Paakig+gv lcl|FitnessBrowser__Caulo:CCNA_02734 100 EADLKAVFERDPACKGYVQPFLFFKGFLALQTHRVSHWLWNQGRETLAFYLQSRSSEVFQVDINPAAKIGKGV 172 689********************************************************************** PP TIGR01172 75 liDhatGvviGetavigddvsiyqgvtLGgtgkekgkRhPtvkegvvigagakvLGnievgenakiGansvvl 147 +iDh+tG+viGetav+gddvs+++gvtLGgtg e+g+RhP++++gv++gagakvLGni+vg+ ak+ ++svvl lcl|FitnessBrowser__Caulo:CCNA_02734 173 FIDHGTGIVIGETAVVGDDVSMLHGVTLGGTGAERGDRHPKIGKGVLLGAGAKVLGNITVGDYAKVASGSVVL 245 ************************************************************************* PP TIGR01172 148 kdvpaeatvvGvpar 162 ++vpa+ t++Gvpar lcl|FitnessBrowser__Caulo:CCNA_02734 246 RPVPAHCTAAGVPAR 260 *************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (162 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory