Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate CCNA_03740 CCNA_03740 cysteine synthase
Query= BRENDA::C4ITG6 (334 letters) >FitnessBrowser__Caulo:CCNA_03740 Length = 328 Score = 424 bits (1090), Expect = e-123 Identities = 213/314 (67%), Positives = 255/314 (81%), Gaps = 3/314 (0%) Query: 22 AGRGRIYDSILDTIGNTPLVRIDKFARENGVKANLLVKLEFFNPLASVKDRIGLAMIEAL 81 AGRG+IYDSI+DTIG+TPLVR+ + + E KA +L KLEFFNP+ASVKDRIG++MIE+L Sbjct: 16 AGRGKIYDSIIDTIGDTPLVRLPRLSAELNPKAEVLAKLEFFNPIASVKDRIGVSMIESL 75 Query: 82 EKQGKAVPGKTVFVEPTSGNTGIALAFAAAAKGYRLILTMPETMSMERRKLLRLLGAELV 141 E QG PG T+ +EPTSGNTGIALAF AAAKGY+L L MPE+MS+ERRK+L LLGA+L Sbjct: 76 EAQGVLKPGATI-IEPTSGNTGIALAFVAAAKGYKLTLVMPESMSIERRKMLLLLGAKLE 134 Query: 142 LTEGAKGMKGAIAEAEAI--GNPNAIIPQQFENPANPEIHRLTTAEEIWNDTNGEADILI 199 LT KGM+GA+ A+ + P A++PQQFEN ANP IHR++TAEEIWNDT G D ++ Sbjct: 135 LTPAEKGMRGAVTRAQELIEATPGAVMPQQFENSANPLIHRVSTAEEIWNDTAGAVDAVV 194 Query: 200 SGIGTGGTITGVGQVIKARKPSFKVVAVEPKDSPVLSGGAPGPHKIQGLGAGFAPKTLDT 259 SG+GTGGTITGVGQ +KARKPS K+VAVEP+ SPVLSGGAPGPHKIQG+GAGF P LD Sbjct: 195 SGVGTGGTITGVGQALKARKPSLKMVAVEPEASPVLSGGAPGPHKIQGIGAGFVPGVLDR 254 Query: 260 GIYDEIVQISNEDAFTNARLVARLEGIPVGISSGAALAAAIEVGKRSENAGKNIVVVIPS 319 G+ D+IVQ+SN+DAF AR A EG+PVGISSGAAL AA ++ R GK IVV+IPS Sbjct: 255 GVIDDIVQVSNDDAFAMARRAAATEGLPVGISSGAALTAAFDLALRDAYKGKTIVVIIPS 314 Query: 320 FAERYLSTALFEGL 333 FAERYLSTALF+GL Sbjct: 315 FAERYLSTALFDGL 328 Lambda K H 0.314 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 328 Length adjustment: 28 Effective length of query: 306 Effective length of database: 300 Effective search space: 91800 Effective search space used: 91800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
Align candidate CCNA_03740 CCNA_03740 (cysteine synthase)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.23607.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-135 435.6 0.5 5.1e-135 435.4 0.5 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03740 CCNA_03740 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03740 CCNA_03740 cysteine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 435.4 0.5 5.1e-135 5.1e-135 3 298 .] 27 325 .. 25 325 .. 0.97 Alignments for each domain: == domain 1 score: 435.4 bits; conditional E-value: 5.1e-135 TIGR01139 3 eliGntPlvrLn...laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGial 72 ++iG+tPlvrL + + kaevl+kle++nP +svkdri+++mie+ e +g+lk+g ti+e+tsGntGial lcl|FitnessBrowser__Caulo:CCNA_03740 27 DTIGDTPLVRLPrlsAELNPKAEVLAKLEFFNPIASVKDRIGVSMIESLEAQGVLKPGATIIEPTSGNTGIAL 99 79********987323445689*************************************************** PP TIGR01139 73 amvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanp 145 a+vaaa+gykl+l+mpe+ms+errk+l +Ga+l Lt++++gm+ga+++a+el+e+tp ++++qfen anp lcl|FitnessBrowser__Caulo:CCNA_03740 100 AFVAAAKGYKLTLVMPESMSIERRKMLLLLGAKLELTPAEKGMRGAVTRAQELIEATP-GAVMPQQFENSANP 171 **********************************************************.556*********** PP TIGR01139 146 eihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggkpgphkiqGig 218 ihr +ta+ei++d+ g++da+v+gvGtGGtitGvg++lk kp++k+vaveP++spvlsgg pgphkiqGig lcl|FitnessBrowser__Caulo:CCNA_03740 172 LIHRVSTAEEIWNDTAGAVDAVVSGVGTGGTITGVGQALKARKPSLKMVAVEPEASPVLSGGAPGPHKIQGIG 244 ************************************************************************* PP TIGR01139 219 agfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtge 290 agf+P vLd+ vid++++vs+++a+++arr a+ eG+ vGissGaa+ aa +a + + k+k+ivvi+p+++e lcl|FitnessBrowser__Caulo:CCNA_03740 245 AGFVPGVLDRGVIDDIVQVSNDDAFAMARRAAATEGLPVGISSGAALTAAFDLALRDAyKGKTIVVIIPSFAE 317 ******************************************************99999************** PP TIGR01139 291 rYlstaLf 298 rYlstaLf lcl|FitnessBrowser__Caulo:CCNA_03740 318 RYLSTALF 325 *******9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (328 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory