Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate CCNA_01603 CCNA_01603 aspartate aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >FitnessBrowser__Caulo:CCNA_01603 Length = 400 Score = 240 bits (612), Expect = 6e-68 Identities = 133/389 (34%), Positives = 212/389 (54%), Gaps = 13/389 (3%) Query: 7 LQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHGYVLS 66 L+R+ + ++ A+A+ L+A G+ +I L G+PDF TP ++ +AA +A+ G Y Sbjct: 8 LRRIAPSATIAISAKARALKAAGRDVIALSAGEPDFDTPDNIKNAAIEAIKAGKTKYTDP 67 Query: 67 NGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTPAFPI 126 +G+ E + A+ K K+ + P ++ + PGGKP +Y A+ PG E+I P P + Sbjct: 68 DGMPELKAAICAKFKRENGLEYKPSQIHVAPGGKPVIYNALVATLNPGDEVIIPAPYWVS 127 Query: 127 YESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEKSAID 186 Y M G TPV + T + K PE + + IT KT+ LI+ +P+NP+G ++ + Sbjct: 128 YPDMTLLAGGTPVSVETTAESGFKITPEALEAAITPKTKWLIINSPSNPSGGAYSRAELQ 187 Query: 187 VLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNY-PDLQDRLIVLDGWSKAYAMTGWR 245 +A+ L +HP V +L+D++Y ++D E T P L DR + ++G SK Y+MTGWR Sbjct: 188 AIADVLLRHPQVWVLTDDMYEHLVFDDFEFTTIAQVEPKLYDRTLTMNGVSKGYSMTGWR 247 Query: 246 MGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKLIHE 305 +G++ PE LI + K+I + S + SQ+A + AL+G D I F +RR L+ Sbjct: 248 IGYAAGPEPLIKAMGKMISQTTSNPCSISQWAALEALNGTQDFIKPNAKLFQERRDLVVS 307 Query: 306 GLNSLPGVECSLPGGAFYAFPKVIG----TGMNG------SEFAKKCMHEAGVAIVPGTA 355 LN G+ C P GAFY +P G T +G +FA + + GVA+V G A Sbjct: 308 MLNQATGLHCPTPEGAFYVYPSCAGLIGKTAPSGKVIESDEDFATELLESEGVAVVHGAA 367 Query: 356 FGKTCQDYVRFSYAASQDNISNALENIKK 384 FG + R SYA S + + +A I++ Sbjct: 368 FG--LSPFFRISYATSNEVLEDACSRIQR 394 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 400 Length adjustment: 31 Effective length of query: 356 Effective length of database: 369 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory