Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate CCNA_03853 CCNA_03853 imidazole glycerol phosphate synthase, cyclase subunit
Query= BRENDA::Q5NMD6 (255 letters) >FitnessBrowser__Caulo:CCNA_03853 Length = 260 Score = 327 bits (839), Expect = 1e-94 Identities = 164/251 (65%), Positives = 200/251 (79%), Gaps = 2/251 (0%) Query: 3 LCTRIIPCLDVADGRVVKGVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGRGT 62 L TRIIPCLDV DGRVVKGVNF L DAGDPVEQA+ YDAAGADEL FLDI+AS EGRG Sbjct: 2 LKTRIIPCLDVKDGRVVKGVNFVSLRDAGDPVEQARAYDAAGADELMFLDITASSEGRGL 61 Query: 63 MLDVVARTAEVCFMPLTVGGGVRQVEDARALLLAGADKVAVNSAAVARPELVAEIADRFG 122 +LDV++RTAEVCFMP++VGGGVRQV D R LLLAGADKV+VN+AAV P+L+A AD FG Sbjct: 62 ILDVISRTAEVCFMPVSVGGGVRQVSDMRRLLLAGADKVSVNTAAVENPDLIAGGADAFG 121 Query: 123 AQCVVAAID--ARRNGDHWEVYTHGGRRPTGINALDHALNLTRLGAGEILLTSMDKDGTR 180 +QCVV AID AR +G W V+T+GGR+ TGI+ ++ A + GAGEILLTSMD+DG + Sbjct: 122 SQCVVVAIDAKAREDGSGWNVWTYGGRKDTGIDVVEWAAKVVERGAGEILLTSMDRDGAK 181 Query: 181 DGYDLELTRLVADSVPVPVIASGGVGNLDHMVEGVTKGHASALLAASIFHFGQYSLAEAH 240 GYD+ L + V +V VPVIASGG G +H++E +GHA+A+LAASIFHFG+ S+ EA Sbjct: 182 IGYDIPLLQAVTGAVNVPVIASGGAGKTEHLIEAAREGHAAAVLAASIFHFGEISIGEAK 241 Query: 241 EALAKAGLTVR 251 +A+A AG+ VR Sbjct: 242 QAMADAGIPVR 252 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate CCNA_03853 CCNA_03853 (imidazole glycerol phosphate synthase, cyclase subunit)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.17691.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-112 360.8 2.9 1.9e-112 360.6 2.9 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03853 CCNA_03853 imidazole glycerol ph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03853 CCNA_03853 imidazole glycerol phosphate synthase, cyclase subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 360.6 2.9 1.9e-112 1.9e-112 1 254 [] 1 252 [. 1 252 [. 0.99 Alignments for each domain: == domain 1 score: 360.6 bits; conditional E-value: 1.9e-112 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevvervaekv 73 ml riipCLdvkdgrvvkGv+f +lrdaGdpve a++yd+ Gadel+flditasse+r +l+v++r+ae lcl|FitnessBrowser__Caulo:CCNA_03853 1 MLKTRIIPCLDVKDGRVVKGVNFVSLRDAGDPVEQARAYDAAGADELMFLDITASSEGRGLILDVISRTAEVC 73 7999********************************************************************* PP TIGR00735 74 fiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaeneeakyevti 146 f+P++vgGG+++++d+++ll aGadkvs+ntaav++p+li+ ad fGsq++vvaidak +++ + ++v + lcl|FitnessBrowser__Caulo:CCNA_03853 74 FMPVSVGGGVRQVSDMRRLLLAGADKVSVNTAAVENPDLIAGGADAFGSQCVVVAIDAKAREDG--SGWNVWT 144 ************************************************************9987..79***** PP TIGR00735 147 kgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgGaGkaehleeafl 219 +gGr+ t++dvvewa++v e+GaGeilltsmd+dG k Gyd+ ll++v av++PviasgGaGk+ehl ea lcl|FitnessBrowser__Caulo:CCNA_03853 145 YGGRKDTGIDVVEWAAKVVERGAGEILLTSMDRDGAKIGYDIPLLQAVTGAVNVPVIASGGAGKTEHLIEAAR 217 ************************************************************************* PP TIGR00735 220 kgkadaaLaasvfhkreltieevkeylaergvkvr 254 +g+a a+Laas+fh++e++i+e k+ +a+ g++vr lcl|FitnessBrowser__Caulo:CCNA_03853 218 EGHAAAVLAASIFHFGEISIGEAKQAMADAGIPVR 252 *********************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (260 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory