Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate CCNA_02335 CCNA_02335 inositol monophosphatase family protein
Query= reanno::azobra:AZOBR_RS03845 (260 letters) >FitnessBrowser__Caulo:CCNA_02335 Length = 278 Score = 201 bits (511), Expect = 1e-56 Identities = 114/255 (44%), Positives = 157/255 (61%), Gaps = 17/255 (6%) Query: 19 ASGPVIRQYFRTPVAVDDK-----------ADASPVTIADREAERTIRAIIEAERPDDGI 67 AS VI FR ++DK A PVT ADR AE IRA+I PD G+ Sbjct: 21 ASADVILPLFRADHGLEDKGAGKNLPRDTHAAFDPVTEADRGAEAAIRALIAQRFPDHGV 80 Query: 68 YGEEFGTKNLDAEWVWVIDPIDGTKSFITGRPIFGTLIALLHRGRPVLGVIDQPIVRDRW 127 GEE+G DAE+VWV+DPIDGT++FI G P++ TLI L H GRPVLG I QP V + + Sbjct: 81 IGEEYGEDRPDAEFVWVLDPIDGTRAFIAGLPLWTTLIGLRHEGRPVLGSIGQPYVNEIF 140 Query: 128 LGVEGRPTLFNG---QPARVRECAGGLAAATLGTTSPD-LFPGADQDAFRRVAGAAKVSV 183 +G G L +G +P RVRECA + A + TT PD F GA++ A+ +V AAK++ Sbjct: 141 IGHAGGARLVSGGEARPIRVRECA-NINDAVIATTDPDACFDGAERGAWLQVRAAAKLAR 199 Query: 184 YGGDCYSYGLLAAGYYDLVVESGLKLYDFAALVPVVTGAGGLMTDWDGRPLDATSSGRVV 243 G D Y+Y ++A G D+V+E+GLK +D A +P++ GAGG++T+W G P+ + G++V Sbjct: 200 LGCDAYAYAMVAMGKMDMVIEAGLKSWDIEAAIPLIEGAGGMVTNWRGEPV-GPNGGQMV 258 Query: 244 AAGDARTHRETLAAL 258 +GD R E L +L Sbjct: 259 ISGDRRPLDEALVSL 273 Lambda K H 0.320 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 278 Length adjustment: 25 Effective length of query: 235 Effective length of database: 253 Effective search space: 59455 Effective search space used: 59455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate CCNA_02335 CCNA_02335 (inositol monophosphatase family protein)
to HMM TIGR02067 (hisN: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02067.hmm # target sequence database: /tmp/gapView.23265.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02067 [M=252] Accession: TIGR02067 Description: his_9_HisN: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-103 330.1 0.0 5.2e-103 329.9 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_02335 CCNA_02335 inositol monophosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_02335 CCNA_02335 inositol monophosphatase family protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 329.9 0.0 5.2e-103 5.2e-103 2 251 .. 12 273 .. 11 274 .. 0.98 Alignments for each domain: == domain 1 score: 329.9 bits; conditional E-value: 5.2e-103 TIGR02067 2 lalalelaeaageailkyfrasdlkvdkksdk..........tpVteADraaEeaireliaakfPddgilGEE 64 +a++l+l++a++++il+ fra++ +dk + k +pVteADr aE+air+lia++fPd+g++GEE lcl|FitnessBrowser__Caulo:CCNA_02335 12 DAFILDLNRASADVILPLFRADHGLEDKGAGKnlprdthaafDPVTEADRGAEAAIRALIAQRFPDHGVIGEE 84 5899*************************99999*************************************** PP TIGR02067 65 fgeeeedaeyvWvlDPiDGTksFirGvPvwgtLiaLlekgkpvlGvisqPalgerfvaakgegallngge.re 136 +ge+++dae+vWvlDPiDGT++Fi+G+P+w+tLi+L+++g+pvlG i qP+++e+f++++g++ l++gge r+ lcl|FitnessBrowser__Caulo:CCNA_02335 85 YGEDRPDAEFVWVLDPIDGTRAFIAGLPLWTTLIGLRHEGRPVLGSIGQPYVNEIFIGHAGGARLVSGGEaRP 157 *******************************************************************9777** PP TIGR02067 137 lrvsevaklsdAvlvttspkaledeeereafeklrrkarltryggdcyayalvAsGrvdlvveaelspyDiaa 209 +rv+e+a+++dAv++tt+p+a++d +er a+ ++r++a+l+r+g+d+yaya+vA+G++d+v+ea+l+++Di+a lcl|FitnessBrowser__Caulo:CCNA_02335 158 IRVRECANINDAVIATTDPDACFDGAERGAWLQVRAAAKLARLGCDAYAYAMVAMGKMDMVIEAGLKSWDIEA 230 ************************************************************************* PP TIGR02067 210 lipiieeAggvitdwkGkeae.eggeavaaanaalhdevlell 251 +ip+ie+Agg++t+w+G+++ +gg++v++++++ de+l +l lcl|FitnessBrowser__Caulo:CCNA_02335 231 AIPLIEGAGGMVTNWRGEPVGpNGGQMVISGDRRPLDEALVSL 273 ********************99*****************9887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (252 nodes) Target sequences: 1 (278 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 4.76 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory