Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate CCNA_01446 CCNA_01446 LL-diaminopimelate aminotransferase
Query= curated2:A5FRC5 (388 letters) >FitnessBrowser__Caulo:CCNA_01446 Length = 406 Score = 336 bits (861), Expect = 8e-97 Identities = 162/374 (43%), Positives = 239/374 (63%), Gaps = 3/374 (0%) Query: 6 RIENLPPYLFVQISKKIAEKRAKGEDVISFAIGDPDLPTPKHILAELCKAAEDPSNHRYP 65 RI LPPY+F +++K A RA+G D+I F +G+PD+PTP+HI+ +L + A DP RY Sbjct: 7 RIRRLPPYVFEEVNKIKARLRAEGTDIIDFGMGNPDMPTPQHIVDKLIETARDPKAGRYS 66 Query: 66 ETEGLPVLRKAMAEWYQKRFGVKLNPDTEVLPLIGSKEGIGHAAWCFLDPGDIALVPNPA 125 ++G+P LRKAMA +Y +RFGVKLNPDTEV+ +GSKEG + A PGD+ + PNPA Sbjct: 67 ASKGVPGLRKAMANYYGRRFGVKLNPDTEVIATLGSKEGFANLAQALTGPGDVIICPNPA 126 Query: 126 YPVYAISSQLAGAEVFNLPLNKGNNFLPNLEAIPQNILSKAKVLWINYPNNPTGAVAGLS 185 YP++A +AG + ++P +L N+ ++ + VL ++YP+NPT L Sbjct: 127 YPIHAFGFIMAGGIIRHVPALSPEEYLSNISRAVKHSVPPPSVLILSYPSNPTAQWVDLD 186 Query: 186 FFQEVANFAAKHNLAVCHDGPYSEIAFDGYKPVSFLEADGAKDVGIEFHSLSKSYNMTGW 245 F+++ A KH+L V D Y EI FD P S L+ DGAKD+ +E +SLSK+Y M GW Sbjct: 187 FYKDAVALAKKHDLLVISDVAYGEIYFDNNPPPSILQVDGAKDIAVEVNSLSKTYAMAGW 246 Query: 246 RIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIAALNGSQEIINQNCAIYQRRRDRLV 305 R+GM VGNA++ AL R KS LD G +Q+ A ALNG Q+ +++ IY+ RRD L+ Sbjct: 247 RVGMVVGNARICAALARVKSYLDYGAYTPVQVAAATALNGPQDCVDEIRGIYKSRRDTLI 306 Query: 306 EALRNIGMEVTAPKASLYIWAPVPESYTSAS---FATELLDKTGVVVTPGTGYGTAGEGY 362 ++++ G ++ P AS++ WA +PE+Y A F+ L+++ GV V PG G+G GEGY Sbjct: 307 KSMKAAGWDIPNPPASMFAWAKIPEAYREAGSMLFSRLLIEEAGVAVAPGIGFGEYGEGY 366 Query: 363 IRLSLTVPDEQIEK 376 +R+ L + +I + Sbjct: 367 VRIGLVENEHRIRQ 380 Lambda K H 0.317 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 406 Length adjustment: 31 Effective length of query: 357 Effective length of database: 375 Effective search space: 133875 Effective search space used: 133875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory