GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Caulobacter crescentus NA1000

Align Aspartate kinase Ask_LysC; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate CCNA_00886 CCNA_00886 aspartokinase

Query= SwissProt::A4VJB4
         (412 letters)



>FitnessBrowser__Caulo:CCNA_00886
          Length = 415

 Score =  392 bits (1008), Expect = e-114
 Identities = 221/415 (53%), Positives = 287/415 (69%), Gaps = 13/415 (3%)

Query: 1   MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ 60
           M+ +V KFGGTSV  +ERI +VA  V      G  + VVVSAMSG+TN L+         
Sbjct: 1   MSRLVMKFGGTSVADLERIRRVARLVAAEVATGKQVAVVVSAMSGKTNELVAWTDGAGRA 60

Query: 61  PV-----PRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQ 115
                    E D +V++GEQVT  LLAM L   G  A S+ G QV ILTD AH +ARI +
Sbjct: 61  AAGLPESDDEYDAVVASGEQVTAGLLAMTLRNMGHKARSFLGWQVPILTDEAHGRARIEE 120

Query: 116 IDAQRIQRDIKAGRVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDV 175
           I  + ++     G + V+AGFQGV     ITTLGRGGSDT+ VA+AAA+K D C IYTDV
Sbjct: 121 IPPENLEECFANGEIAVIAGFQGVTPNRRITTLGRGGSDTSAVAIAAAVKGD-CDIYTDV 179

Query: 176 DGVYTTDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQE- 234
           DGVYTTDPR+ +KA+RL KI++EEMLEMASLG+KVLQ R+VE A  + VP+RVL SF E 
Sbjct: 180 DGVYTTDPRIESKARRLAKISYEEMLEMASLGAKVLQTRSVEMAMAHRVPVRVLSSFVEP 239

Query: 235 ----GPGTLITLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVE 290
               G GT++  DEEE ME+ I+SG+A++RDEAK+T+ G+PD PGV+ +I G ++ ANV 
Sbjct: 240 GEAPGQGTIVC-DEEEIMEKRIVSGVAYSRDEAKITLLGLPDHPGVSSQIFGRLAEANVN 298

Query: 291 VDMIVQNVAHD-NTTDFTFTVHRNDYNNALQVLQGIAAEMGAREAIGDTNIAKVSIVGVG 349
           VDMIVQ+ A   +T +  FTV + D   A++++Q    E+G      + ++AKVS++GVG
Sbjct: 299 VDMIVQSRARSADTANMEFTVGKRDATRAVEIVQAAQKEIGFEAVAVNEDVAKVSVIGVG 358

Query: 350 MRSHAGVASRMFEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELD 404
           MRSHAGVA  MF+ALA++NINIQ+ISTSEIK+SV+I+  Y ELAVRALH  + LD
Sbjct: 359 MRSHAGVAQSMFQALAEKNINIQVISTSEIKISVLIDAAYTELAVRALHAVYGLD 413


Lambda     K      H
   0.317    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 445
Number of extensions: 22
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 412
Length of database: 415
Length adjustment: 31
Effective length of query: 381
Effective length of database: 384
Effective search space:   146304
Effective search space used:   146304
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate CCNA_00886 CCNA_00886 (aspartokinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.14148.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.14148.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.