Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate CCNA_03800 CCNA_03800 diaminopimelate epimerase
Query= curated2:B4RCE2 (277 letters) >FitnessBrowser__Caulo:CCNA_03800 Length = 288 Score = 332 bits (851), Expect = 6e-96 Identities = 174/284 (61%), Positives = 207/284 (72%), Gaps = 12/284 (4%) Query: 5 MGRPFLKMNGLGNDFVVVETRSAPFEPTAAQVRAIADRAT-----GIGCDQLIAVDP--A 57 M R FLKMNGLGNDFVV++T + F+PT Q+RAIA R GIGCDQ+IA+DP A Sbjct: 1 MSRTFLKMNGLGNDFVVIQTLTEAFDPTPEQIRAIAKRPGVDGKGGIGCDQVIAIDPPRA 60 Query: 58 EGADAHVRFWNADGEEVGACGNGTRCVGWLLMQSSGKDEAVIETRAGRLVATRAGERLVS 117 EGA A+VRFWN+DGE GACGNGTRCV WLLMQS+GKD +T AGRL AG++LV+ Sbjct: 61 EGASAYVRFWNSDGEVAGACGNGTRCVAWLLMQSAGKDAVAFDTVAGRLSGVAAGDKLVT 120 Query: 118 VDMGPPRLEWNEIPLAEPHDTRALDV-VLYHHADLMAPPGCVSMGNPHVVFFVPDAEQAP 176 VDMGPP L+W +IPLAE +T +++ V A L+ P CVSMGNPHVVFFV DA Sbjct: 121 VDMGPPGLDWTQIPLAEEMNTERVELQVGPIDAPLVHTPVCVSMGNPHVVFFV-DAPVTD 179 Query: 177 --AAEAGPAIEGHPLFPEHVNVGFAQVKAPDRIRLRVWERGAGLTKACGTGACAAMVAAS 234 A G +E HPLFPE VNVGFA + + D IRL+VWERGAGLT+ACGTGACAA VAA Sbjct: 180 DFARGTGSLVEHHPLFPEGVNVGFAHIASRDHIRLKVWERGAGLTQACGTGACAAQVAAV 239 Query: 235 RRGLIGRHATMELDGGELFVEWR-ADGHVIMTGPAAVDFQGELP 277 RRGL R A +E D G L +EWR +DGHVIMTGP +++ G+LP Sbjct: 240 RRGLTDRKARVEFDTGSLTIEWRESDGHVIMTGPITMEYAGKLP 283 Lambda K H 0.320 0.137 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 277 Length of database: 288 Length adjustment: 26 Effective length of query: 251 Effective length of database: 262 Effective search space: 65762 Effective search space used: 65762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate CCNA_03800 CCNA_03800 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.29799.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-75 239.5 0.0 2.7e-75 239.3 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03800 CCNA_03800 diaminopimelate epime Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03800 CCNA_03800 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 239.3 0.0 2.7e-75 2.7e-75 2 268 .. 4 282 .. 3 284 .. 0.92 Alignments for each domain: == domain 1 score: 239.3 bits; conditional E-value: 2.7e-75 TIGR00652 2 eFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdr.....htgvgaDgvllvep.sseeadvklrifNsDGS 68 +Flkm+GlgNdFv++++++e + + +e++r++++r + g+g+D+v+ + p e a +++r++NsDG lcl|FitnessBrowser__Caulo:CCNA_03800 4 TFLKMNGLGNDFVVIQTLTEAFDPT-PEQIRAIAKRpgvdgKGGIGCDQVIAIDPpRAEGASAYVRFWNSDGE 75 59*****************665555.********9855554679**********97788899*********** PP TIGR00652 69 eaemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltvekeeekee 141 a CGNg Rc+a ++++++k + + + t ag+++ + v+vdmg p + ++ipl +e ++e+ e lcl|FitnessBrowser__Caulo:CCNA_03800 76 VAGACGNGTRCVAWLLMQSAGK--DAVAFDTVAGRLSGVAAGDK-LVTVDMGPPGLDWTQIPLAEEMNTERVE 145 ********************99..8**********998766666.*******************988888888 PP TIGR00652 142 llalev........lvvdvGnPHlvvfved.vekldleelgklleaheefpegvNvefvevkkedeiklrvyE 205 l+ + ++v++GnPH+v+fv+ v + + +g+l+e+h+ fpegvNv f+++ ++d+i+l+v+E lcl|FitnessBrowser__Caulo:CCNA_03800 146 LQVGPIdaplvhtpVCVSMGNPHVVFFVDApVTDDFARGTGSLVEHHPLFPEGVNVGFAHIASRDHIRLKVWE 218 888777889876555**************9666677788********************************** PP TIGR00652 206 RGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedg.kvyltGpavlvlegel 268 RGag T+aCGtGa+A+ v+a++ g+t++k++v+++ g+L+ie++e++ +v++tGp ++ + g+l lcl|FitnessBrowser__Caulo:CCNA_03800 219 RGAGLTQACGTGACAAQVAAVRRGLTDRKARVEFDTGSLTIEWRESDgHVIMTGPITMEYAGKL 282 *******************************************99877**********999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (288 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.28 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory