Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (characterized)
to candidate CCNA_02296 CCNA_02296 diaminopimelate decarboxylase
Query= SwissProt::B4XMC6 (405 letters) >lcl|FitnessBrowser__Caulo:CCNA_02296 CCNA_02296 diaminopimelate decarboxylase Length = 421 Score = 295 bits (754), Expect = 2e-84 Identities = 160/387 (41%), Positives = 244/387 (63%), Gaps = 7/387 (1%) Query: 13 TPFYLYDFDKIKQAFLNYKEAFKGR---KSLICYALKANSNLSILSLLAHLESGADCVSI 69 TP Y+Y +++ F+ +++A LI YA+KANSN+++L +L L +GAD VS Sbjct: 27 TPVYVYSRATLERHFVVFRDALAMSGVVDPLIAYAVKANSNVAVLKVLGDLGAGADTVSE 86 Query: 70 GEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIK 129 GE++RAL AGI RIVFSGVGK+ EI AL+ + +NVES EL I +A LG++ Sbjct: 87 GEVRRALAAGIPGERIVFSGVGKARREIAFALQAGVAEINVESEPELNLIAEVAAELGVR 146 Query: 130 ARISIRINPNIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQ 189 A+++ R+NP++ A H I+TG ENKFGV EA ++ A +A L+PV V HIGSQ Sbjct: 147 AKVAFRVNPDVAAGGHAKIATGKSENKFGVSFAEAARLYANASNNANLQPVGVACHIGSQ 206 Query: 190 LLDLEPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGVSYENE-ETIKLYDYAQGILNA 248 + DL P+ A K+ + + L+A G+ + D+GGG+GV Y N E ++A + Sbjct: 207 ITDLAPMRAAFTKMRGLVEQLLAEGLSVERLDLGGGLGVPYFNHPEPPSPAEFAAMVGEV 266 Query: 249 LQGLDLTIICEPGRSIVAESGELITQVLY-EKKAQNKRFVIVDAGMNDFLRPSLYHAKHA 307 QGL +T+ EPGR I A +G L+++V++ ++ + ++F+++DA MND +RP++Y A H Sbjct: 267 TQGLPVTLAFEPGRVIAANAGVLVSEVIHVHERPEGRKFLVIDAAMNDLVRPAMYDAFHD 326 Query: 308 IRVITPSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYGSSMASQYN 367 IR + G + DVVGPVCE+ DTF +D LP GD +A GAYG++MAS+YN Sbjct: 327 IRPVIQRTGETV--YDVVGPVCETGDTFTRDRALPPFAAGDLVAFMSAGAYGAAMASEYN 384 Query: 368 SRPKLLELALEDHKIRVIRKREALEDL 394 +RP + E+ ++ + VIR+R +++ Sbjct: 385 TRPLVPEVLVDGDRYAVIRQRPTYDEM 411 Lambda K H 0.319 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 421 Length adjustment: 31 Effective length of query: 374 Effective length of database: 390 Effective search space: 145860 Effective search space used: 145860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate CCNA_02296 CCNA_02296 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.27838.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-143 462.9 0.0 4.5e-143 462.6 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_02296 CCNA_02296 diaminopimelate decar Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_02296 CCNA_02296 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.6 0.0 4.5e-143 4.5e-143 9 416 .. 11 415 .. 6 416 .. 0.97 Alignments for each domain: == domain 1 score: 462.6 bits; conditional E-value: 4.5e-143 TIGR01048 9 leiegvdlkelaeefgtPlYvydeetlrerlealkeafka...ees.lvlYAvKAnsnlavlrllaeeGlgld 77 l +egv+l+++a+e gtP+Yvy+++tl++++ ++ a + l++YAvKAnsn+avl++l ++G+g+d lcl|FitnessBrowser__Caulo:CCNA_02296 11 LACEGVPLAKIAAEVGTPVYVYSRATLERHFVVFRDALAMsgvV-DpLIAYAVKANSNVAVLKVLGDLGAGAD 82 7899********************************99874433.26************************** PP TIGR01048 78 vvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnp 150 vs+GE+ ralaAg++ e+ivfsg+gk ++e++ al++++ inv+s+ el+l+ e+a+elg +a+v++Rvnp lcl|FitnessBrowser__Caulo:CCNA_02296 83 TVSEGEVRRALAAGIPGERIVFSGVGKARREIAFALQAGVAEINVESEPELNLIAEVAAELGVRAKVAFRVNP 155 ************************************************************************* PP TIGR01048 151 dvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelk 223 dv a h +i+TG+ e+KFG++++ea++ y a+++++l++vG+ +HIGSqi+dl+p+++a+ k+ l+e+l lcl|FitnessBrowser__Caulo:CCNA_02296 156 DVAAGGHAKIATGKSENKFGVSFAEAARLYANASNNANLQPVGVACHIGSQITDLAPMRAAFTKMRGLVEQLL 228 ************************************************************************* PP TIGR01048 224 eegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGRslvanagvlltrVesv 296 +eg+++e ldlGGGlg++y ++ e+p+++e+a+++ e + gl ++l +EpGR ++anagvl+ +V +v lcl|FitnessBrowser__Caulo:CCNA_02296 229 AEGLSVERLDLGGGLGVPYFNHPEPPSPAEFAAMVGEVTQ-----GLPVTLAFEPGRVIAANAGVLVSEVIHV 296 ********************************99885444.....59************************** PP TIGR01048 297 Keves.rkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplCEsgDvlakdrelpeveeGdll 368 e+++ rkf ++Da+mndl+Rpa+Y+a h+i+++ ++ + ++++dvvGp+CE+gD++++dr+lp +Gdl+ lcl|FitnessBrowser__Caulo:CCNA_02296 297 HERPEgRKFLVIDAAMNDLVRPAMYDAFHDIRPV--IQRTGETVYDVVGPVCETGDTFTRDRALPPFAAGDLV 367 **9989****************************..6677789****************************** PP TIGR01048 369 avasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416 a +saGAYga+m+s+Yn+rp + evlv+++++ +ir+r t++++la + lcl|FitnessBrowser__Caulo:CCNA_02296 368 AFMSAGAYGAAMASEYNTRPLVPEVLVDGDRYAVIRQRPTYDEMLARD 415 ********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.82 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory