Align Arogenate dehydratase 2; PhADT2; Prephenate dehydratase ADT3; EC 4.2.1.91; EC 4.2.1.51 (characterized)
to candidate CCNA_03028 CCNA_03028 prephenate dehydratase
Query= SwissProt::D3U716 (394 letters) >FitnessBrowser__Caulo:CCNA_03028 Length = 283 Score = 186 bits (473), Expect = 5e-52 Identities = 113/285 (39%), Positives = 157/285 (55%), Gaps = 16/285 (5%) Query: 108 RVAYQGVRGAYSESAAEKAYPNCEAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSIHR 167 ++A+QG GA S A +P+ EA PC+ F+ AFEA++ + ++PIENS+ G + Sbjct: 6 KIAFQGEPGANSHEACRTYFPDYEAYPCKTFEEAFEAIKSGVAQLGMIPIENSIAGRVAD 65 Query: 168 NYDLLLRHRLHIVGEVKLAIRHCLLANNGVKIEDLKRVLSHPQALAQCENNLTKLGLVRE 227 + LL L I+GE IR L+AN GVK+ED+K V S P AL+QC N+L +LG+ E Sbjct: 66 VHHLLPASGLKIIGERFKPIRFQLMANKGVKLEDIKVVSSMPIALSQCRNSLKRLGVETE 125 Query: 228 AVDDTAGAAKYIAFQQLKDAGAVASLAAARIYGLNVLAQDIQDDSDNVTRFLMLA--REP 285 A DTAGAAK +A + AVA AA IYGL++LA+DI+D+ N TRFL++ + P Sbjct: 126 AAGDTAGAAKALALKPNPTHAAVAPALAAEIYGLDILARDIEDERHNTTRFLVMTADKAP 185 Query: 286 IIPGTDKPFKTSVVFSLDEGPGVLFKALAVFAMRNINLTKIESRPLQKQALRVLDDSADG 345 P TS VF + P L+KAL FA +N+TK+ES Sbjct: 186 AAPDFTHRCVTSFVFRVRNLPAALYKALGGFATNGVNMTKLESYM-----------EGGN 234 Query: 346 FPKYFPYLFYVDFEASMADQRAQNALGHLKEFATFLRVLGSYPSD 390 F F FY + + D+ AL LK F+ +LG YP+D Sbjct: 235 FTATF---FYAEVDGRPEDRNLALALDELKFFSERFEILGVYPAD 276 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 283 Length adjustment: 28 Effective length of query: 366 Effective length of database: 255 Effective search space: 93330 Effective search space used: 93330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory