Align Delta-1-pyrroline-5-carboxylate synthase; P5CS; Aldehyde dehydrogenase family 18 member A1; EC 2.7.2.11; EC 1.2.1.41 (characterized)
to candidate CCNA_03543 CCNA_03543 gamma-glutamyl phosphate reductase
Query= SwissProt::P54886 (795 letters) >FitnessBrowser__Caulo:CCNA_03543 Length = 424 Score = 266 bits (681), Expect = 1e-75 Identities = 168/411 (40%), Positives = 226/411 (54%), Gaps = 19/411 (4%) Query: 367 GEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGR-LAAPLLKR 425 G AR G R L PEQR I +A + + D IL AN KDL AE ++ P+L R Sbjct: 16 GRTAREGARALRLATPEQRTAAIQAMAVAIREDADAILTANAKDLARAEANGVSGPMLDR 75 Query: 426 LSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPD 485 L+L ++L +A G+ +AA D VG R L++ +V PIGV+ +I+ESRP+ Sbjct: 76 LALDAARLEGVAAGVEAVAAVP-DPVGVATSRWTRPNGLDIARVRTPIGVIAMIYESRPN 134 Query: 486 CLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEA-VQLVNTREEVED 544 AAL + SGN ++L+GG E HSN +H L G+ A VQ V T + Sbjct: 135 VTADAAALCVRSGNAVILRGGSECIHSNLAIHAAIARGLQKAGLPTAAVQAVKTPDRAAV 194 Query: 545 ---LCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLV 601 L LD+ IDLIIPRG LV +Q A+ PV+GH EG+ H++V + A + K +V Sbjct: 195 GMILAGLDRTIDLIIPRGGKSLVARVQAEARA-PVLGHLEGLNHVFVHAAADLKKAVEVV 253 Query: 602 RDSKCEYPAACNALETLLIHR---DLLRTPLFDQIIDM---LRVEQVKIHAGPKFASYLT 655 ++K + C + ETLLI + D L P+ D +I LR + P T Sbjct: 254 VNAKLRRVSVCGSAETLLIDQAAADKLLPPIADALIKAGCELRGDAAARAIEP------T 307 Query: 656 FSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTEDENTAEFFLQHVD 715 + V+ TEY L + VVD V A HI YGS HTD I+TED AE F+ VD Sbjct: 308 MKKATVEDWTTEYLAPILSVAVVDGVAGAARHIASYGSGHTDAIITEDAAAAEAFIAEVD 367 Query: 716 SACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRG 766 SA V NAST+F+DG FG GAE+GI+T ++HARGPVG E L T K+++RG Sbjct: 368 SAIVLVNASTQFADGGEFGFGAEIGIATDKLHARGPVGAEQLTTFKYVVRG 418 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 692 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 795 Length of database: 424 Length adjustment: 36 Effective length of query: 759 Effective length of database: 388 Effective search space: 294492 Effective search space used: 294492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory