Align tryptophan synthase (EC 4.2.1.20) (characterized)
to candidate CCNA_03658 CCNA_03658 tryptophan synthase beta chain
Query= BRENDA::Q97TX6 (429 letters) >FitnessBrowser__Caulo:CCNA_03658 Length = 406 Score = 137 bits (344), Expect = 8e-37 Identities = 115/367 (31%), Positives = 165/367 (44%), Gaps = 45/367 (12%) Query: 76 GRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVYYAKLDNAKFVTTETG 135 GRP+P+ A+RL E+ G KIY K + +TGSHKIN+AL + A + ETG Sbjct: 65 GRPSPLYFAERLTEHFGG-AKIYFKRDELNHTGSHKINNALGQILLAMRMGKTRIIAETG 123 Query: 136 AGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEVHPSPSDLTEFGRQLL 195 AGQ G + A A F + ++M T + + M + GAEV P S G L Sbjct: 124 AGQHGVATATVCARFGLPCVVYMGATDVERQKPNVFRMNLLGAEVRPVSS-----GTGTL 178 Query: 196 AKDSNHPGSLGIAISDAVEYAHKNGGKYVVGSVVNS---DIM---FKTIAGMEAKKQ-ME 248 N A+ D V H Y++G+ +M F+++ G EA++Q +E Sbjct: 179 KDAMNE------AMRDWVTNVHDT--YYLIGTAAGPHPYPVMVRDFQSVIGAEAREQILE 230 Query: 249 LIGEDPDYIIGVVGGGSNYAALAYPFLGDE---------LRSGKVRRKYIASGSSEVPKM 299 + G PD ++ +GGGSN L +PFLGDE G K+ AS + P + Sbjct: 231 MEGRLPDAVVACIGGGSNAIGLFHPFLGDEGVRLIGVEAAGHGVSTDKHAASLTGGRPGV 290 Query: 300 TKGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLISKGIVQARD 359 G Y D + + GL Y G+ P S L G + Sbjct: 291 LHGNRTYLLQDD------------DGQIIDAHSISAGLDYPGIGPEHSFLHDIGRAEYVS 338 Query: 360 YSQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDL 419 + E+ + KL S LEG IPA E +HAL + EIA+E G+ K V+++ G G D+ Sbjct: 339 TTDTEALEAFKLCSTLEGIIPALEPAHALARVGEIAQEL---GKGKIVVMNLCGRGDKDI 395 Query: 420 GNYASVL 426 A L Sbjct: 396 FTVAEAL 402 Lambda K H 0.316 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 406 Length adjustment: 32 Effective length of query: 397 Effective length of database: 374 Effective search space: 148478 Effective search space used: 148478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate CCNA_03658 CCNA_03658 (tryptophan synthase beta chain)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.24438.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-196 637.4 0.0 4.9e-196 637.2 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03658 CCNA_03658 tryptophan synthase b Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03658 CCNA_03658 tryptophan synthase beta chain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 637.2 0.0 4.9e-196 4.9e-196 1 384 [. 18 401 .. 18 402 .. 1.00 Alignments for each domain: == domain 1 score: 637.2 bits; conditional E-value: 4.9e-196 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiylkre 73 g+fg fGG+yv+e+l++ + +l kay +ak+d+ef+++l+++ +yagrp+pl+fa++l+++ ggakiy+kr+ lcl|FitnessBrowser__Caulo:CCNA_03658 18 GRFGGFGGRYVAETLMPLVLDLGKAYADAKADPEFQAQLKSYNTHYAGRPSPLYFAERLTEHFGGAKIYFKRD 90 78*********************************************************************** PP TIGR00263 74 dllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqklnvfrmel 146 +l+htG+hkinnalgq+lla r+Gk+riiaetGaGqhGvatat++a++gl c+vymGa+dverqk+nvfrm+l lcl|FitnessBrowser__Caulo:CCNA_03658 91 ELNHTGSHKINNALGQILLAMRMGKTRIIAETGAGQHGVATATVCARFGLPCVVYMGATDVERQKPNVFRMNL 163 ************************************************************************* PP TIGR00263 147 lgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeevkeqilekegrlP 219 lga+v pv+sG+ tlkda+nea+rdWvt+v+dt+y++G+a+GphP+P +vr+fqsvig+e++eqile+egrlP lcl|FitnessBrowser__Caulo:CCNA_03658 164 LGAEVRPVSSGTGTLKDAMNEAMRDWVTNVHDTYYLIGTAAGPHPYPVMVRDFQSVIGAEAREQILEMEGRLP 236 ************************************************************************* PP TIGR00263 220 daviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhGaktkllqdedGqieea 292 dav+ac+GGGsnaiG+f++f+ de v+ligvea+G+G++t+khaa+l+ G++GvlhG++t+llqd+dGqi +a lcl|FitnessBrowser__Caulo:CCNA_03658 237 DAVVACIGGGSNAIGLFHPFLGDEGVRLIGVEAAGHGVSTDKHAASLTGGRPGVLHGNRTYLLQDDDGQIIDA 309 ************************************************************************* PP TIGR00263 293 hsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeGiipalesshalaaleklapklkkdei 365 hs+saGldypg+gPeh++l+++graey++ td+ealea+kl+s eGiipale +hala + ++a++l k +i lcl|FitnessBrowser__Caulo:CCNA_03658 310 HSISAGLDYPGIGPEHSFLHDIGRAEYVSTTDTEALEAFKLCSTLEGIIPALEPAHALARVGEIAQELGKGKI 382 ************************************************************************* PP TIGR00263 366 vvvnlsGrGdkdletvaka 384 vv+nl+GrGdkd++tva+a lcl|FitnessBrowser__Caulo:CCNA_03658 383 VVMNLCGRGDKDIFTVAEA 401 ****************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory