Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate CCNA_01975 CCNA_01975 anthranilate phosphoribosyltransferase
Query= SwissProt::P83827 (329 letters) >FitnessBrowser__Caulo:CCNA_01975 Length = 341 Score = 273 bits (699), Expect = 3e-78 Identities = 160/321 (49%), Positives = 203/321 (63%), Gaps = 7/321 (2%) Query: 10 GEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVH 69 G+ L++ +A A + GE +P + A + A+ LRGE EIAA ARAMR AA PL H Sbjct: 15 GQTLDDSDAELFFAACLRGEPTPAQVAAAVTAIRLRGETVGEIAACARAMRRAAIPLE-H 73 Query: 70 RRPLLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDL 129 ++D+ GTGGDG +N+ST VAA GG+ VAKHGNRA +S++G+AD+L ALGV++ Sbjct: 74 PYDVIDVCGTGGDGLHTLNISTAVGFVAAGGGLKVAKHGNRAITSKSGTADVLTALGVNI 133 Query: 130 EAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYV 189 +A E+ +A++E G FLFA+ H AM+HV+P+R +LG RT+FNLLGPLTNPAGA V Sbjct: 134 DATREQQRKALDEAGICFLFAQAHHGAMKHVSPIRQQLGFRTIFNLLGPLTNPAGAKRQV 193 Query: 190 LGVFSPEWLAPMAEALERLGA-RGLVVHGEGADEL-VLGENRVVEVGKGA---YALTPEE 244 +GV +P ++ P+A+AL LGA R VHG G DEL GE V E G + +TPE Sbjct: 194 VGVSAPRFVEPIAKALGALGAERAWSVHGSGMDELTTTGETEVAEWRDGVVRLFKITPEA 253 Query: 245 VGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSLKEGV 304 VGL RA L L GG P NAA RL G E GP D V L A A F A K +L EGV Sbjct: 254 VGLPRAALADLTGGDPAFNAAALTRLFDG-ETGPYRDIVLLNAAAAFLVADKVETLVEGV 312 Query: 305 ALAREVLASGEAYLLLERYVA 325 ALA E + SG A L VA Sbjct: 313 ALAAEAIDSGRAKAALAGLVA 333 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 341 Length adjustment: 28 Effective length of query: 301 Effective length of database: 313 Effective search space: 94213 Effective search space used: 94213 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate CCNA_01975 CCNA_01975 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.30848.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-118 379.5 0.2 8.7e-118 379.3 0.2 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_01975 CCNA_01975 anthranilate phosphor Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_01975 CCNA_01975 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.3 0.2 8.7e-118 8.7e-118 2 328 .. 10 332 .. 9 334 .. 0.98 Alignments for each domain: == domain 1 score: 379.3 bits; conditional E-value: 8.7e-118 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDi 74 kl+d+++L++ +ae ++ + ++ge ++aq+aA+++a+r +get+ eia+ a+a+r+ a +e+ ++++D+ lcl|FitnessBrowser__Caulo:CCNA_01975 10 AKLADGQTLDDSDAELFFAACLRGEPTPAQVAAAVTAIRLRGETVGEIAACARAMRRAAIPLEH--PYDVIDV 80 799***********************************************************87..7****** PP TIGR01245 75 vGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlf 147 +GTGGDgl+t+NiSTa +vaa+ G+kvaKhGnr+++sksG aDvL algvn++++ e+ +++l+e gi+Flf lcl|FitnessBrowser__Caulo:CCNA_01975 81 CGTGGDGLHTLNISTAVGFVAAGGGLKVAKHGNRAITSKSGTADVLTALGVNIDATREQQRKALDEAGICFLF 153 ************************************************************************* PP TIGR01245 148 APkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedgl 220 A ++h a+k+v p+R++Lg+rt+fNlLGPL+nPa ak+qv+Gv+ + +ve +a++l +lg++ra vhg +g+ lcl|FitnessBrowser__Caulo:CCNA_01975 154 AQAHHGAMKHVSPIRQQLGFRTIFNLLGPLTNPAGAKRQVVGVSAPRFVEPIAKALGALGAERAWSVHG-SGM 225 *********************************************************************.*** PP TIGR01245 221 DEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaa 293 DE+++tget+vae +dg ++ ++++pe gl+ra l +l gg+++ na++l++++ g+ ++ rdiv+lNaaa lcl|FitnessBrowser__Caulo:CCNA_01975 226 DELTTTGETEVAEWRDGVVRLFKITPEAVGLPRAALADLTGGDPAFNAAALTRLFDGET-GPYRDIVLLNAAA 297 ****************************************************9999998.9************ PP TIGR01245 294 alyvagkakdlkegvelakeaiksgkalekleelv 328 a +va+k+++l egv la eai+sg+a + l+ lv lcl|FitnessBrowser__Caulo:CCNA_01975 298 AFLVADKVETLVEGVALAAEAIDSGRAKAALAGLV 332 ****************************9998776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.41 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory