Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate CCNA_02539 CCNA_02539 aspartate aminotransferase
Query= SwissProt::P96847 (388 letters) >FitnessBrowser__Caulo:CCNA_02539 Length = 381 Score = 330 bits (846), Expect = 4e-95 Identities = 176/384 (45%), Positives = 243/384 (63%), Gaps = 10/384 (2%) Query: 7 LRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSV 66 +RA + PF+ + + A + + ++++ GQPS GAP A A L +GY Sbjct: 1 MRAEIEPFHAIAISRLAHQLKMEGRSIIHMEFGQPSTGAPSKALAKAHDILDAEAMGYWE 60 Query: 67 ALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYP 126 + P LR+ IA YQ +G+TVEP+ +++T G+S +LA + F GDR+A+A PGY Sbjct: 61 S---PLLREKIAQRYQTLYGVTVEPERIILTCGASPALVLALSSLFKPGDRIALARPGYV 117 Query: 127 CYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELA 186 YRN L AL E VEI CGP+ RFQ TA+ LA+++P GV+VASPANPTGT+I P EL Sbjct: 118 AYRNTLKALHLEPVEIACGPEDRFQLTAKHLADLEPAPVGVIVASPANPTGTIIEPAELE 177 Query: 187 AIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWL 246 AIA C A +R+ISDE+YHGL Y G +T + + +A++VNSFSKY++M GWRLGWL Sbjct: 178 AIAKVCAARGIRIISDEIYHGLSYAG--RTPSMLEFAPDALIVNSFSKYFSMAGWRLGWL 235 Query: 247 LVP--TVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDG 304 L P L RA GN + P L+Q A ++A + E +G++ Y NR L+LD Sbjct: 236 LTPPGEDLDRA-RAYVGNLFLTAPSLAQHAGLAAM--DCIDELEGHIDVYRANRQLMLDA 292 Query: 305 LRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVR 364 L +G+ +AP DGAFY++A+++ T DSL FC LL DTGVA APG+DFD G F+R Sbjct: 293 LPALGLKEIAPPDGAFYIWANIAHLTDDSLGFCEDLLRDTGVATAPGVDFDPVEGKRFIR 352 Query: 365 ISFAGPSGDIEEALRRIGSWLPSQ 388 SFA + ++EEALRRI W ++ Sbjct: 353 FSFAVSTPEVEEALRRITPWFEAR 376 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 381 Length adjustment: 30 Effective length of query: 358 Effective length of database: 351 Effective search space: 125658 Effective search space used: 125658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory