Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate Echvi_0226 Echvi_0226 carbamoyl-phosphate synthase, small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__Cola:Echvi_0226 Length = 364 Score = 296 bits (759), Expect = 5e-85 Identities = 168/376 (44%), Positives = 220/376 (58%), Gaps = 22/376 (5%) Query: 3 KSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGN 62 + A L+LEDGT F+G IG G+ GE+ FNT MTGYQEI TDPSY+ QIV T HIGN Sbjct: 4 QKATLLLEDGTVFYGTLIGKHGTNGGEICFNTGMTGYQEIYTDPSYTGQIVVTTTSHIGN 63 Query: 63 VGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLL 122 G D++ ES +V+ I S T+ L +L+ + I IAD+DTRKL R + Sbjct: 64 YGVIDSEAESDGPTIASIVVNSFSEIYSRLDATQSLQEFLESNGITGIADVDTRKLVRHI 123 Query: 123 REKGAQNGCIIAG-DN-PDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGG 180 R KGA N I + DN D L+K P + G++L+ +V T E Y + T+ Sbjct: 124 RSKGAMNAIISSEFDNLEDLQKELDKV---PDMAGLELSSKVCTKEPYYVGDENSTIK-- 178 Query: 181 LPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSN 240 V D+G KRNILR L RG + PA+T+ D+ P+ FLSN Sbjct: 179 -------------VACVDYGIKRNILRNLAARGVYCKVFPAKTAVADMEAWQPNAYFLSN 225 Query: 241 GPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDV 300 GPGDPA DYA+ +++ L + PVFGICLGHQLLA A G KT KM GH G NHP+K++ Sbjct: 226 GPGDPAVMDYAVETVKEILALNKPVFGICLGHQLLAEAVGIKTYKMHHGHRGINHPIKNL 285 Query: 301 EKNVVMITAQNHGFAV--DEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASP 358 IT+QNHGF + +++ ++ +TH L D T+ GI D+PAFS Q HPE++P Sbjct: 286 NTGKSEITSQNHGFNIVREDSENHPDIEITHVHLNDNTVAGIKLKDRPAFSVQYHPESAP 345 Query: 359 GPHDAAPLFDHFIELI 374 GPHD+ LFD FI LI Sbjct: 346 GPHDSRYLFDDFISLI 361 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 364 Length adjustment: 30 Effective length of query: 352 Effective length of database: 334 Effective search space: 117568 Effective search space used: 117568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Echvi_0226 Echvi_0226 (carbamoyl-phosphate synthase, small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.11686.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-142 458.2 0.2 1.1e-141 458.0 0.2 1.0 1 lcl|FitnessBrowser__Cola:Echvi_0226 Echvi_0226 carbamoyl-phosphate s Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0226 Echvi_0226 carbamoyl-phosphate synthase, small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 458.0 0.2 1.1e-141 1.1e-141 1 360 [. 6 362 .. 6 363 .. 0.98 Alignments for each domain: == domain 1 score: 458.0 bits; conditional E-value: 1.1e-141 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvk 74 atl+ledGtvf g+ +g++++ Ge++FnT+mtGYqEi tDpsY+gqivv t+ +ignygv +++aes+ ++++ lcl|FitnessBrowser__Cola:Echvi_0226 6 ATLLLEDGTVFYGTLIGKHGTNGGEICFNTGMTGYQEIYTDPSYTGQIVVTTTSHIGNYGVIDSEAESDGPTIA 79 689*********************************************************************** PP TIGR01368 75 glvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakespkv 148 ++vv+ +s+ +s a++sL+efl+++gi +i++vDTR+lv+++R+kg+m+a+is+e + e+l++++++ p++ lcl|FitnessBrowser__Cola:Echvi_0226 80 SIVVNSFSEIYSRLDATQSLQEFLESNGITGIADVDTRKLVRHIRSKGAMNAIISSEFDNLEDLQKELDKVPDM 153 ************************************************************************** PP TIGR01368 149 kevnlvkevstkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgill 222 ++++l ++v+tke+y++ + e+++ +v+ +d+G+K+nilr+L++rgv +v+pa+t ++++++ +p++ +l lcl|FitnessBrowser__Cola:Echvi_0226 154 AGLELSSKVCTKEPYYVGD----ENSTIKVACVDYGIKRNILRNLAARGVYCKVFPAKTAVADMEAWQPNAYFL 223 ***************9996....566689********************************************* PP TIGR01368 223 snGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqNH 296 snGPGdPa +++a+etvk++l ++P+fGIclGhqlla a+g ktyk++ GhrG Nhp+k+l+tg+ eitsqNH lcl|FitnessBrowser__Cola:Echvi_0226 224 SNGPGDPAVMDYAVETVKEILALNKPVFGICLGHQLLAEAVGIKTYKMHHGHRGINHPIKNLNTGKSEITSQNH 297 ************************************************************************** PP TIGR01368 297 gya.vdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 g++ v e+s ++ ++e+thv+lnD+tv+g++ k+ p+fsvQyHPe++pGphd++ylFd+f++li+ lcl|FitnessBrowser__Cola:Echvi_0226 298 GFNiVREDSENHPDIEITHVHLNDNTVAGIKLKDRPAFSVQYHPESAPGPHDSRYLFDDFISLIN 362 **83578888999************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.53 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory