Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate Echvi_0121 Echvi_0121 3-dehydroquinate synthase
Query= curated2:A6LEZ7 (353 letters) >FitnessBrowser__Cola:Echvi_0121 Length = 345 Score = 272 bits (696), Expect = 8e-78 Identities = 138/345 (40%), Positives = 214/345 (62%), Gaps = 7/345 (2%) Query: 4 QKVVICKDLKSELQDFLSSLKYDKLFILMDTNTKEKCFPLV-EDIPAFQKAPILVMEAGD 62 + ++ + +L+ FL S + KL ++ D+NT + C+PL+ E +P + EAG+ Sbjct: 2 ESIIFSTQIAPDLERFLKSKNFSKLGVITDSNTSQACYPLIREALPLHEH---FAFEAGE 58 Query: 63 MNKGFVSLAQIWTALSNEGASRNSLLVNLGGGMITDMGGFAGATFKRGIRTINIPTTLMA 122 +NK + +IW +++ G R SL++NLGGG+ DMGGF +T+KRG++ INIPTTL++ Sbjct: 59 VNKNLDTCQKIWQWMTDCGFDRKSLIINLGGGVTGDMGGFCASTYKRGVKFINIPTTLLS 118 Query: 123 SVDAAVGGKTGINFNGLKNEVGSFYPPLCVFIDCDFLRTLDRDNILSGYAEMIKHGLISS 182 VDA+VGGK G++FNG KN +G F P V I FL +L + SGYAE++KHGLI + Sbjct: 119 QVDASVGGKLGVDFNGFKNHIGVFNEPEAVIISAAFLSSLPLPELRSGYAEVLKHGLIRN 178 Query: 183 MENYASVMLFDIDTMNYSYLNSLVGQSVAVKERIVEEDPKEQGIRKALNFGHTIGHAFES 242 + S+ L + + ++ ++ +SV +K+ +V +DPKE G+RK LNFGHT+GHA ES Sbjct: 179 ENYFNSLKLQNWEDQRWT---EIIEKSVYIKKDVVTKDPKEDGLRKILNFGHTVGHAVES 235 Query: 243 LSFLKMRPILHGHAVAAGIVSELYLSHKLCGFPMEKLSQVVYYIKEYYPALFFDCTDYDT 302 R +LHG A+A G+++E YLS K P E+L + + E + + D D Sbjct: 236 FYLDTERHLLHGEAIAIGMIAEAYLSQKHIRLPKEELQSITTALLEVFGKVEIPKEDLDA 295 Query: 303 LYELMTHDKKNEGGIINFTLLKNVGDVRINQSVTKEKILESLDFY 347 + +L DKKN+G IN +LLK +G+ N +V+ + I++SL FY Sbjct: 296 IAQLCFQDKKNDGKTINCSLLKKIGECDYNIAVSLDDIIDSLHFY 340 Lambda K H 0.321 0.139 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 345 Length adjustment: 29 Effective length of query: 324 Effective length of database: 316 Effective search space: 102384 Effective search space used: 102384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Echvi_0121 Echvi_0121 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.8666.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-103 331.6 0.0 3.2e-103 331.5 0.0 1.0 1 lcl|FitnessBrowser__Cola:Echvi_0121 Echvi_0121 3-dehydroquinate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0121 Echvi_0121 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 331.5 0.0 3.2e-103 3.2e-103 8 336 .. 9 330 .. 2 338 .. 0.92 Alignments for each domain: == domain 1 score: 331.5 bits; conditional E-value: 3.2e-103 TIGR01357 8 gllkklveelaeka.sklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldqlleekl 80 ++ l + l++k+ skl vitd+++++ + ++eal ++++ +++ge +K+l+t++k+++++ + ++ lcl|FitnessBrowser__Cola:Echvi_0121 9 QIAPDLERFLKSKNfSKLGVITDSNTSQACYPLIREALPL----HEHFAFEAGEVNKNLDTCQKIWQWMTDCGF 78 55555666666655699***********999999999965....88999************************* PP TIGR01357 81 erksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVlidl 154 +rks+++++GGGv gD++GF A+ty+RG++++++PTtll++vD+svGGK g+++++ kN iG f +P+aV+i+ lcl|FitnessBrowser__Cola:Echvi_0121 79 DRKSLIINLGGGVTGDMGGFCASTYKRGVKFINIPTTLLSQVDASVGGKLGVDFNGFKNHIGVFNEPEAVIISA 152 ************************************************************************** PP TIGR01357 155 kvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesglR 228 ++l++lp elr+G+aEv+Khgli +++ f+ l+ ++ e + ++e+i++s+ +K++vV++D+ke glR lcl|FitnessBrowser__Cola:Echvi_0121 153 AFLSSLPLPELRSGYAEVLKHGLIRNENYFNSLKLQNW------EDQRWTEIIEKSVYIKKDVVTKDPKEDGLR 220 *******************************9998443......3489************************** PP TIGR01357 229 alLNfGHtlgHaiEallkyk...lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkkklsv 299 ++LNfGHt+gHa+E+++ + l HGea+aiGm+ ea+ls+k l++e+l+++++ l ++ +++++k ++ lcl|FitnessBrowser__Cola:Echvi_0121 221 KILNFGHTVGHAVESFYLDTerhLLHGEAIAIGMIAEAYLSQKHIRLPKEELQSITTALLEVFGKVEIPK-EDL 293 **************987555567**********************************************7.9** PP TIGR01357 300 eellkallkDKKnegskiklvlleeiGkaalasevte 336 +++++ + +DKKn+g++i+ ll++iG++ + v+ lcl|FitnessBrowser__Cola:Echvi_0121 294 DAIAQLCFQDKKNDGKTINCSLLKKIGECDYNIAVSL 330 ****************************988766655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.85 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory