GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroB in Echinicola vietnamensis KMM 6221, DSM 17526

Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate Echvi_0121 Echvi_0121 3-dehydroquinate synthase

Query= curated2:A6LEZ7
         (353 letters)



>FitnessBrowser__Cola:Echvi_0121
          Length = 345

 Score =  272 bits (696), Expect = 8e-78
 Identities = 138/345 (40%), Positives = 214/345 (62%), Gaps = 7/345 (2%)

Query: 4   QKVVICKDLKSELQDFLSSLKYDKLFILMDTNTKEKCFPLV-EDIPAFQKAPILVMEAGD 62
           + ++    +  +L+ FL S  + KL ++ D+NT + C+PL+ E +P  +       EAG+
Sbjct: 2   ESIIFSTQIAPDLERFLKSKNFSKLGVITDSNTSQACYPLIREALPLHEH---FAFEAGE 58

Query: 63  MNKGFVSLAQIWTALSNEGASRNSLLVNLGGGMITDMGGFAGATFKRGIRTINIPTTLMA 122
           +NK   +  +IW  +++ G  R SL++NLGGG+  DMGGF  +T+KRG++ INIPTTL++
Sbjct: 59  VNKNLDTCQKIWQWMTDCGFDRKSLIINLGGGVTGDMGGFCASTYKRGVKFINIPTTLLS 118

Query: 123 SVDAAVGGKTGINFNGLKNEVGSFYPPLCVFIDCDFLRTLDRDNILSGYAEMIKHGLISS 182
            VDA+VGGK G++FNG KN +G F  P  V I   FL +L    + SGYAE++KHGLI +
Sbjct: 119 QVDASVGGKLGVDFNGFKNHIGVFNEPEAVIISAAFLSSLPLPELRSGYAEVLKHGLIRN 178

Query: 183 MENYASVMLFDIDTMNYSYLNSLVGQSVAVKERIVEEDPKEQGIRKALNFGHTIGHAFES 242
              + S+ L + +   ++    ++ +SV +K+ +V +DPKE G+RK LNFGHT+GHA ES
Sbjct: 179 ENYFNSLKLQNWEDQRWT---EIIEKSVYIKKDVVTKDPKEDGLRKILNFGHTVGHAVES 235

Query: 243 LSFLKMRPILHGHAVAAGIVSELYLSHKLCGFPMEKLSQVVYYIKEYYPALFFDCTDYDT 302
                 R +LHG A+A G+++E YLS K    P E+L  +   + E +  +     D D 
Sbjct: 236 FYLDTERHLLHGEAIAIGMIAEAYLSQKHIRLPKEELQSITTALLEVFGKVEIPKEDLDA 295

Query: 303 LYELMTHDKKNEGGIINFTLLKNVGDVRINQSVTKEKILESLDFY 347
           + +L   DKKN+G  IN +LLK +G+   N +V+ + I++SL FY
Sbjct: 296 IAQLCFQDKKNDGKTINCSLLKKIGECDYNIAVSLDDIIDSLHFY 340


Lambda     K      H
   0.321    0.139    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 363
Number of extensions: 14
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 353
Length of database: 345
Length adjustment: 29
Effective length of query: 324
Effective length of database: 316
Effective search space:   102384
Effective search space used:   102384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Echvi_0121 Echvi_0121 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.4929.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.4929.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.