Align chorismate synthase (EC 4.2.3.5) (characterized)
to candidate Echvi_1518 Echvi_1518 chorismate synthase
Query= BRENDA::B5AAU3 (442 letters) >FitnessBrowser__Cola:Echvi_1518 Length = 360 Score = 420 bits (1080), Expect = e-122 Identities = 211/352 (59%), Positives = 263/352 (74%), Gaps = 5/352 (1%) Query: 55 GNIFGDYFQVATYGESHGGGVGCVISGCPPRIPLTEEDMQGDLDRRRPGQSRITTPRKET 114 GN FG F+++T+GESHG G+G +I GCP +P+ E ++ +L RR+PGQS+ITT RKE Sbjct: 2 GNSFGKVFKISTFGESHGKGLGVIIDGCPAGLPIDEAFIRQELQRRKPGQSKITTQRKEE 61 Query: 115 DTCKILSGTYEGMTTGTPIHVFVPNTDQRGGDYTEMAKAYRPSHADLTYDLKYGVRSVQG 174 D C+ILSG +EG +TGTPI + + NTDQ+ DY+ +A YRPSHAD TY K+GVR +G Sbjct: 62 DECQILSGVFEGKSTGTPIAIVIMNTDQKSKDYSHIADKYRPSHADYTYQEKFGVRDYRG 121 Query: 175 GGRSSARETIGRVAAGAVAKKILKLKCGVEILAFVSKVHQVVLPEDAVDYETLTLDQIES 234 GGRSSARET RVAAGAVAK LK GVEI A+VS+ + L + Y+ L +IE Sbjct: 122 GGRSSARETAARVAAGAVAKLFLK-HIGVEINAYVSQAGHIKLDK---PYQELDFAEIEK 177 Query: 235 NICRCPDPEYAQKMIDAIDKVRINGNSIGGVVTCIARNVPRGLGSPVFDKLEALLAKAML 294 NI RCPDPE AQ MID ID++R N +++GGVV+C+A+NVP GLG PVFD+L A L K+ML Sbjct: 178 NIVRCPDPEVAQDMIDYIDEIRKNRDTVGGVVSCVAKNVPVGLGEPVFDRLHADLGKSML 237 Query: 295 SLPASKGFEIGSGFAGTDLTGSEHNDEFYMDEGGNVRTRTNRSGGVQGGISNGETIYFKV 354 S+ A KGFE GSGF G + GSEHND FYMD G VRT+TN SGG+QGGISNGE IYF+V Sbjct: 238 SINAVKGFEYGSGFEGVTMLGSEHNDAFYMD-GDTVRTKTNHSGGIQGGISNGEDIYFRV 296 Query: 355 AFKPTATIGKKQNTVTRDHEDIELLTRGRHDPCVVPRAVPMVETMAALVLMD 406 AFKP ATI K Q++V + + + + +GRHDPCVVPRAVP+VE MAALVL D Sbjct: 297 AFKPVATIMKDQDSVNQAGDQVTVSGKGRHDPCVVPRAVPIVEAMAALVLAD 348 Lambda K H 0.317 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 360 Length adjustment: 31 Effective length of query: 411 Effective length of database: 329 Effective search space: 135219 Effective search space used: 135219 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Echvi_1518 Echvi_1518 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.22328.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-153 494.4 0.6 9.3e-153 494.2 0.6 1.0 1 lcl|FitnessBrowser__Cola:Echvi_1518 Echvi_1518 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_1518 Echvi_1518 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 494.2 0.6 9.3e-153 9.3e-153 1 348 [. 9 354 .. 9 357 .. 0.98 Alignments for each domain: == domain 1 score: 494.2 bits; conditional E-value: 9.3e-153 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPial 74 +++ tfGeSHgk lg+iidG+Pagl+++e+ i++el+rR+pgqs+ t++rkEeDe +ilsGvfeGk tG+Pia+ lcl|FitnessBrowser__Cola:Echvi_1518 9 FKISTFGESHGKGLGVIIDGCPAGLPIDEAFIRQELQRRKPGQSKITTQRKEEDECQILSGVFEGKSTGTPIAI 82 7899********************************************************************** PP TIGR00033 75 likNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayv 148 +i N+d++skdy++i++++RP+Hadyty++K+g++d++gggrsSaReTaarvaaGavak +Lk+ g+ei ayv lcl|FitnessBrowser__Cola:Echvi_1518 83 VIMNTDQKSKDYSHIADKYRPSHADYTYQEKFGVRDYRGGGRSSARETAARVAAGAVAKLFLKH-IGVEINAYV 155 ****************************************************************.88******* PP TIGR00033 149 vklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkl 222 ++ g+++l++ ++e +++k+ vrcpd+e ++ m ++id+++k++d+vGgvv++v++nvpvglGep+fd+l lcl|FitnessBrowser__Cola:Echvi_1518 156 SQAGHIKLDK-PYQELDFAEIEKNIVRCPDPEVAQDMIDYIDEIRKNRDTVGGVVSCVAKNVPVGLGEPVFDRL 228 *********7.666678999****************************************************** PP TIGR00033 223 daelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGedirvriavKpip 296 +a l++ +lsinAvKg+e G+GFe +++ Gse+nD ++++ d +r+ktn+sGGi+GGi+nGedi++r+a+Kp++ lcl|FitnessBrowser__Cola:Echvi_1518 229 HADLGKSMLSINAVKGFEYGSGFEGVTMLGSEHNDAFYMDGDTVRTKTNHSGGIQGGISNGEDIYFRVAFKPVA 302 ************************************************************************** PP TIGR00033 297 tikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladallekr 348 ti k++ +v+ ++ + + kgRhDpcvvpravp+vEam alvlad +l kr lcl|FitnessBrowser__Cola:Echvi_1518 303 TIMKDQDSVNQAGDQVTVSGKGRHDPCVVPRAVPIVEAMAALVLADFVLLKR 354 ***********888888888***************************99877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory