GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroD in Echinicola vietnamensis KMM 6221, DSM 17526

Align 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 (characterized)
to candidate Echvi_1810 Echvi_1810 3-dehydroquinate dehydratase, type II

Query= SwissProt::P43877
         (154 letters)



>FitnessBrowser__Cola:Echvi_1810
          Length = 139

 Score =  135 bits (340), Expect = 3e-37
 Identities = 65/136 (47%), Positives = 91/136 (66%), Gaps = 2/136 (1%)

Query: 3   KILLLNGPNLNMLGKREPHIYGSQTLSDIEQHLQQSAQAQGYELDYFQANGEESLINRIH 62
           KIL++NGPNLN+LGKREP IYGS++  D    L+ +       L Y+Q+N E  L+N+IH
Sbjct: 2   KILIINGPNLNLLGKREPEIYGSKSFEDFFGELETTFS--NISLSYYQSNVEGELVNKIH 59

Query: 63  QAFQNTDFIIINPGAFTHTSVAIRDALLAVSIPFIEVHLSNVHAREPFRHHSYLSDVAKG 122
           +     D I++N GA+THTSVAI DA+  V+ P +E+H+SN++ RE FRH S +S    G
Sbjct: 60  EVGFTYDAILLNAGAYTHTSVAISDAIAGVTTPVMEIHISNIYKRETFRHKSIISKECIG 119

Query: 123 VICGLGAKGYDYALDF 138
           +I GLG KGY   + +
Sbjct: 120 MIAGLGLKGYALGIQY 135


Lambda     K      H
   0.320    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 86
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 154
Length of database: 139
Length adjustment: 16
Effective length of query: 138
Effective length of database: 123
Effective search space:    16974
Effective search space used:    16974
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 42 (20.8 bits)

Align candidate Echvi_1810 Echvi_1810 (3-dehydroquinate dehydratase, type II)
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))

Software error:

../bin/blast/fastacmd -i /tmp/list.31902.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.31902.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.