GapMind for Amino acid biosynthesis

 

Aligments for a candidate for CGL in Echinicola vietnamensis KMM 6221, DSM 17526

Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate Echvi_2080 Echvi_2080 Cystathionine beta-lyases/cystathionine gamma-synthases

Query= BRENDA::Q5H4T8
         (397 letters)



>lcl|FitnessBrowser__Cola:Echvi_2080 Echvi_2080 Cystathionine
           beta-lyases/cystathionine gamma-synthases
          Length = 381

 Score =  416 bits (1069), Expect = e-121
 Identities = 205/380 (53%), Positives = 266/380 (70%), Gaps = 3/380 (0%)

Query: 15  LSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPTRFAYERCVA 74
           +   T  IH G +PDP+TGA+M PI+ TSTY Q SPG+H+GFEYSRTHNPTR A ++ +A
Sbjct: 1   MKFGTKVIHAGVAPDPTTGAIMTPIFQTSTYVQKSPGQHKGFEYSRTHNPTRDALQKSIA 60

Query: 75  ALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFV 134
           ALE G     F+SGM A   +++LL  G  V++ +DLYGGT+R+F +V  +  G+ F FV
Sbjct: 61  ALENGKHGLCFSSGMGAIDALIKLLSPGDEVISTNDLYGGTYRIFTKVFAK-YGIKFHFV 119

Query: 135 DLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQ 194
            + DPA+ +  I   T+++W ETPTNPM+ ++DI A+A IA KH LL  VDNTFA+P LQ
Sbjct: 120 SMDDPASIEKYINDKTRLIWAETPTNPMMNIIDIKALAAIAGKHDLLLGVDNTFATPYLQ 179

Query: 195 RPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLA 254
            PL LGADLV+HS TKYL GHSD+V G  VV D+  LAE +AF+QNS G   GP D FL 
Sbjct: 180 NPLDLGADLVMHSVTKYLAGHSDVVMGALVVNDD-RLAEDLAFIQNSCGATPGPQDCFLV 238

Query: 255 LRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVS 314
           LRG+KTL LRM  HC+N   +A +L  HP ++KV +PG   HP H +A +QM  FGG++S
Sbjct: 239 LRGIKTLHLRMERHCQNGKTIAGYLRHHPKVDKVYWPGFEDHPNHDIAAKQMRDFGGMIS 298

Query: 315 IVLKGG-FDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALV 373
             + G   + AK+  E    F+LAESLGGVESL  HPA MTHASIP   RE++G++D+L+
Sbjct: 299 FSIVGDKQEDAKKVLENLHYFSLAESLGGVESLCGHPASMTHASIPKVEREKVGLTDSLI 358

Query: 374 RLSVGIEDLGDLRGDLERAL 393
           RLSVG+ED  DL+ DL  AL
Sbjct: 359 RLSVGVEDAEDLKNDLAAAL 378


Lambda     K      H
   0.320    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 467
Number of extensions: 21
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 381
Length adjustment: 30
Effective length of query: 367
Effective length of database: 351
Effective search space:   128817
Effective search space used:   128817
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory